(data stored in ACNUC7421 zone)

EMBL: CP000431.PE102

CP000431.PE102       Location/Qualifiers
FT   CDS             106333..106569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00102"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91938"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ8"
FT                   /protein_id="ABG91938.1"
FT                   /translation="MADNNSGPAEAVKGVVEDVKGKAKEAAGAVSGQDDLTREGKAQQD
FT                   KAAAQREAAAKEAEAEKARGKAEAQEARQRAEQ"
     MADNNSGPAE AVKGVVEDVK GKAKEAAGAV SGQDDLTREG KAQQDKAAAQ REAAAKEAEA        60
     EKARGKAEAQ EARQRAEQ                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page