(data stored in ACNUC7421 zone)

EMBL: CP000431.PE103

CP000431.PE103       Location/Qualifiers
FT   CDS             106670..106948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00103"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91939"
FT                   /db_xref="GOA:Q0SKJ7"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ7"
FT                   /protein_id="ABG91939.1"
FT                   /translation="MLGLGILGWIIIGGLAGWIGSKIMKTDAQMGIILNIVVGIVGGLL
FT                   GGFILRLFGTDVEGGGLWFSFFTCLLGAVILLFLVKLVTGRSTAGRR"
     MLGLGILGWI IIGGLAGWIG SKIMKTDAQM GIILNIVVGI VGGLLGGFIL RLFGTDVEGG        60
     GLWFSFFTCL LGAVILLFLV KLVTGRSTAG RR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page