(data stored in ACNUC7421 zone)

EMBL: CP000431.PE104

CP000431.PE104       Location/Qualifiers
FT   CDS             107026..107589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91940"
FT                   /db_xref="GOA:Q0SKJ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ6"
FT                   /protein_id="ABG91940.1"
FT                   /translation="MASTPAVGYSWGMDSRGPARDDANWNFRARHETETQRLDRNWSGL
FT                   LQELRVVQTGVQLLTGFLLTLPFQQRFEDLSDSEVAIYLATVALSVTSTMLLVAPAGLH
FT                   RMLFRRHALPDLVSASHRLAICGIATLALALIGVVALIFSFVISPIAGVVAAAVALAMF
FT                   CGLWVFAAILRSRHRSTDGDSADR"
     MASTPAVGYS WGMDSRGPAR DDANWNFRAR HETETQRLDR NWSGLLQELR VVQTGVQLLT        60
     GFLLTLPFQQ RFEDLSDSEV AIYLATVALS VTSTMLLVAP AGLHRMLFRR HALPDLVSAS       120
     HRLAICGIAT LALALIGVVA LIFSFVISPI AGVVAAAVAL AMFCGLWVFA AILRSRHRST       180
     DGDSADR                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page