(data stored in ACNUC7421 zone)

EMBL: CP000431.PE105

CP000431.PE105       Location/Qualifiers
FT   CDS             107669..108112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00105"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91941"
FT                   /db_xref="GOA:Q0SKJ5"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91941.1"
FT                   /translation="MTDIHRGDTPRVQPPGAAHDLDDLSTVQLVERLTDQVTGLVRTEM
FT                   THALTEVKDKGTRFGIGAGVSGAGVLLLLSGFGALVATAILGLATALDPWLAALIVAAV
FT                   LIVVGSVVAAVGARRAKNALPPVPARTANSVRADVDTVKEGLR"
     MTDIHRGDTP RVQPPGAAHD LDDLSTVQLV ERLTDQVTGL VRTEMTHALT EVKDKGTRFG        60
     IGAGVSGAGV LLLLSGFGAL VATAILGLAT ALDPWLAALI VAAVLIVVGS VVAAVGARRA       120
     KNALPPVPAR TANSVRADVD TVKEGLR                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page