(data stored in ACNUC7421 zone)

EMBL: CP000431.PE106

CP000431.PE106       Location/Qualifiers
FT   CDS             108548..108871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91942"
FT                   /db_xref="GOA:Q0SKJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ4"
FT                   /protein_id="ABG91942.1"
FT                   /translation="MTYQPDNGPSRELNSEHHPQDDAHTMRNHAGEAITDSRNWPGYIL
FT                   IAAGIAVLGLTLVAAGYGFEGWALIGGIACVLCLVVGTGLVLLERRRVKALEGRELTDQ
FT                   EGH"
     MTYQPDNGPS RELNSEHHPQ DDAHTMRNHA GEAITDSRNW PGYILIAAGI AVLGLTLVAA        60
     GYGFEGWALI GGIACVLCLV VGTGLVLLER RRVKALEGRE LTDQEGH                     107
//

If you have problems or comments...

PBIL Back to PBIL home page