(data stored in ACNUC7421 zone)

EMBL: CP000431.PE107

CP000431.PE107       Location/Qualifiers
FT   CDS             108868..109449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91943"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91943.1"
FT                   /translation="MTDPKVDLHQYLQAARDALLWKLDGLSEYDIRRPMTPTGTNLLGL
FT                   VKHLTGVEIGYFGETFGRSVEYPPWVTGAAEDNVDMWATPGESREYIVGQYRTAWAHAD
FT                   HTIRALPLDAPGRVPHWPGDRRDVTLHRILVHVIAETHRHAGHADIVRELVDGTVGMRA
FT                   DNTNVPAEDRMWWETYRTRLERAAREAGQG"
     MTDPKVDLHQ YLQAARDALL WKLDGLSEYD IRRPMTPTGT NLLGLVKHLT GVEIGYFGET        60
     FGRSVEYPPW VTGAAEDNVD MWATPGESRE YIVGQYRTAW AHADHTIRAL PLDAPGRVPH       120
     WPGDRRDVTL HRILVHVIAE THRHAGHADI VRELVDGTVG MRADNTNVPA EDRMWWETYR       180
     TRLERAAREA GQG                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page