(data stored in ACNUC7421 zone)

EMBL: CP000431.PE108

CP000431.PE108       Location/Qualifiers
FT   CDS             complement(109457..111190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00108"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91944"
FT                   /db_xref="GOA:Q0SKJ2"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91944.1"
FT                   /translation="MERRVSARKVAHRRRIAGSLIAPGALGLAALLATPWSNPGSPATT
FT                   ATALTAAASDACYDMVSIAVAGRGDTPRDGTRMLVAPDGTRLPASYSSDYSSPWIDEVV
FT                   NAPQQSVGGGSYAAVYIEYPANMNSYEDAVNAGVDNTETVMRSIHASCPDTKFSIVGYS
FT                   EGADVARRVAMEVGNQDGRDGSYDILDPAAVVGVVILADAGRNLGGGPFPGSENEFRNP
FT                   DGFDLAYQSGQKGTSGRGALPGTSGSFGALDGKVASFCSEGDLTCSAPENIALLQLAIN
FT                   VGRQLNVDSLQKDGLTPATGQDLAVVLGQIALAAFADIQSQGDWMQSDETFLDVLIKVS
FT                   DPAYKPDSGAAQSDTSTGPISSNQAVDLVYLPAKVRNEIIGFIADNQNTIQVAMSDPYQ
FT                   QTLGEGTGHHFDYWRDANAGSGKPLTSAQYAAAWLTHLAQEAEKGESRAAAAEASTAKL
FT                   ASASTKETETEAARVAPTTTDSAKKAQLAGNPVSATTTTSSSPTPTTTVATTTSPEPTT
FT                   AVEVAAETTTSVSAPQAVAGTPDTSVVTTTAAEPTTTTESESPTTTTPVVTTTTLQPAA
FT                   G"
     MERRVSARKV AHRRRIAGSL IAPGALGLAA LLATPWSNPG SPATTATALT AAASDACYDM        60
     VSIAVAGRGD TPRDGTRMLV APDGTRLPAS YSSDYSSPWI DEVVNAPQQS VGGGSYAAVY       120
     IEYPANMNSY EDAVNAGVDN TETVMRSIHA SCPDTKFSIV GYSEGADVAR RVAMEVGNQD       180
     GRDGSYDILD PAAVVGVVIL ADAGRNLGGG PFPGSENEFR NPDGFDLAYQ SGQKGTSGRG       240
     ALPGTSGSFG ALDGKVASFC SEGDLTCSAP ENIALLQLAI NVGRQLNVDS LQKDGLTPAT       300
     GQDLAVVLGQ IALAAFADIQ SQGDWMQSDE TFLDVLIKVS DPAYKPDSGA AQSDTSTGPI       360
     SSNQAVDLVY LPAKVRNEII GFIADNQNTI QVAMSDPYQQ TLGEGTGHHF DYWRDANAGS       420
     GKPLTSAQYA AAWLTHLAQE AEKGESRAAA AEASTAKLAS ASTKETETEA ARVAPTTTDS       480
     AKKAQLAGNP VSATTTTSSS PTPTTTVATT TSPEPTTAVE VAAETTTSVS APQAVAGTPD       540
     TSVVTTTAAE PTTTTESESP TTTTPVVTTT TLQPAAG                                577
//

If you have problems or comments...

PBIL Back to PBIL home page