(data stored in ACNUC7421 zone)

EMBL: CP000431.PE109

CP000431.PE109       Location/Qualifiers
FT   CDS             complement(111306..111737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91945"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ1"
FT                   /protein_id="ABG91945.1"
FT                   /translation="MHQRGVNRRRKTRDVRSILPERQRPLERRGVEVGRVRGAGGDHRR
FT                   RRHPYSRGAKGCGVYRRWSGTGVSRRRFAQALVREMPHTLALLQTGRLNEWRATLLVRE
FT                   TACLSAADRAIVDRRLCSDPAAARDSAVETLLITHLRAS"
     MHQRGVNRRR KTRDVRSILP ERQRPLERRG VEVGRVRGAG GDHRRRRHPY SRGAKGCGVY        60
     RRWSGTGVSR RRFAQALVRE MPHTLALLQT GRLNEWRATL LVRETACLSA ADRAIVDRRL       120
     CSDPAAARDS AVETLLITHL RAS                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page