(data stored in ACNUC7421 zone)

EMBL: CP000431.PE110

CP000431.PE110       Location/Qualifiers
FT   CDS             111753..112478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00110"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0007600 -
FT                   sensory perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91946"
FT                   /db_xref="GOA:Q0SKJ0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ0"
FT                   /protein_id="ABG91946.1"
FT                   /translation="MPNGPSEMTHTGGDAPSAVFARLAEMVYDGDDFTQVYQAICDAAA
FT                   TLVPGCAHASLMLKENDRHVTVAASDDIAAQVDALERAEQEGPCLDAIENDAPQVESEL
FT                   ARSTQWPRLARRAIAETPVRGAAGFRLMIRGRKVGALNLFSDNAGEFTDKSIDQAILIT
FT                   AFAAVTLTALHEHQEAQTLREGLASNREIGKAIGLLMAFHDISEGRAFDLLRKTSQDMN
FT                   IKLTGVAREVIAHHNSKFD"
     MPNGPSEMTH TGGDAPSAVF ARLAEMVYDG DDFTQVYQAI CDAAATLVPG CAHASLMLKE        60
     NDRHVTVAAS DDIAAQVDAL ERAEQEGPCL DAIENDAPQV ESELARSTQW PRLARRAIAE       120
     TPVRGAAGFR LMIRGRKVGA LNLFSDNAGE FTDKSIDQAI LITAFAAVTL TALHEHQEAQ       180
     TLREGLASNR EIGKAIGLLM AFHDISEGRA FDLLRKTSQD MNIKLTGVAR EVIAHHNSKF       240
     D                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page