(data stored in ACNUC7421 zone)

EMBL: CP000431.PE112

CP000431.PE112       Location/Qualifiers
FT   CDS             113149..113472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00112"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0004518 - nuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI8"
FT                   /protein_id="ABG91948.1"
FT                   /translation="MSGRQPPRGHPTASVAETVRVLLDTAGPTYVSESHVTLKDTPTFL
FT                   FQLLSPAHRRTSISALGRAGYVRYDGSTATRLHAAAVRVDDEYGGDLRRPARACDQETS
FT                   ATS"
     MSGRQPPRGH PTASVAETVR VLLDTAGPTY VSESHVTLKD TPTFLFQLLS PAHRRTSISA        60
     LGRAGYVRYD GSTATRLHAA AVRVDDEYGG DLRRPARACD QETSATS                     107
//

If you have problems or comments...

PBIL Back to PBIL home page