(data stored in ACNUC7421 zone)

EMBL: CP000431.PE114

CP000431.PE114       Location/Qualifiers
FT   CDS             114072..114644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91950"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI6"
FT                   /protein_id="ABG91950.1"
FT                   /translation="MCRPKGSSSNGGAVDRPSRKATIEKIRAGMSRSRARLRPRSEHGQ
FT                   NGPYRTKESTMAKYLLLGHYRGAPASVNDVAMDQWTPEEISAYVQYMNDFAARLESTGE
FT                   FVDSQALSPEGTFVRYDGEGRPPITDGPFAETKDLIAGWMVIDVETHERALELAGELSA
FT                   APGADGKPIHEWLGVRPFLAVSPTATE"
     MCRPKGSSSN GGAVDRPSRK ATIEKIRAGM SRSRARLRPR SEHGQNGPYR TKESTMAKYL        60
     LLGHYRGAPA SVNDVAMDQW TPEEISAYVQ YMNDFAARLE STGEFVDSQA LSPEGTFVRY       120
     DGEGRPPITD GPFAETKDLI AGWMVIDVET HERALELAGE LSAAPGADGK PIHEWLGVRP       180
     FLAVSPTATE                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page