(data stored in ACNUC7421 zone)

EMBL: CP000431.PE117

CP000431.PE117       Location/Qualifiers
FT   CDS             complement(117414..117848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91953"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI3"
FT                   /protein_id="ABG91953.1"
FT                   /translation="MNITTLVLEKSRVVVQWREDGMSYVAREEDLPRLEARPDTIGSIW
FT                   HPPFTERQVVGFEEAPPGDLDRPSWWAMYGYADPEVQVTVTVDDQPDPIVHRIGLVWAC
FT                   EWISYPTRAHVHRSDWDTPDLIRFIRPEFLPPAPYPEHVR"
     MNITTLVLEK SRVVVQWRED GMSYVAREED LPRLEARPDT IGSIWHPPFT ERQVVGFEEA        60
     PPGDLDRPSW WAMYGYADPE VQVTVTVDDQ PDPIVHRIGL VWACEWISYP TRAHVHRSDW       120
     DTPDLIRFIR PEFLPPAPYP EHVR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page