(data stored in ACNUC7421 zone)

EMBL: CP000431.PE118

CP000431.PE118       Location/Qualifiers
FT   CDS             complement(117896..119854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00118"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91954"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI2"
FT                   /protein_id="ABG91954.1"
FT                   /translation="MARVTKYLNLPRPKRASPAKTLILASLASVLFATGGGIAAAQPTT
FT                   TPTPTPSTTTTTPTSPTPTETTAERVTPSSTVPSSPPASPSGTVPAVESTPEASAAPDV
FT                   TTPAPSGSAQTDSSAPTTTPSESTTPSSAPANGKKIPYTGLPTENPNATIVPGKMRSDR
FT                   EELPEGFTKEDADKAEMKEAELQKQASGLRAAVAPGCQVYWPSDFQVCGAIRDKYNSLG
FT                   AQFSFLGFPTTNELTNPDGFGRRSVFVNGPIYWSAASGAHPVVNHFFAAWQRNNWETGP
FT                   LGYPTTDEIVNPDGLGRRQEFQNTAAIYWKLNEAWAIRGAIRDKWNTVNAERPGSLLGY
FT                   PLSDEIVLPDGQGRMNRFERGVLYWHPSHGAHPVVSGILDQWTASGYETGAYGYPTADE
FT                   VTLQDIARQQQFQNGILYSPKRVAADAAYKDYMQAPAAAQCAAPLGSRVGAWTCTKAGG
FT                   AAAALPAPPQFNGPGEYCDVNFGGCWNVYDDFRADYQGDVVFGAGPQIIGNGSVVVEWK
FT                   LAGPYTQITRATVSSNDAVMGRVVFAGALQNGAVGVANGGSLIHSTQPQFAPGPHMTGR
FT                   AVGLPNPSGMELEDRRMRDHNYVVQISVEFSEWPGYWYFYVRSPVAHYDDDDPNDIYRF
FT                   MGADQLPGNPVGGDWKW"
     MARVTKYLNL PRPKRASPAK TLILASLASV LFATGGGIAA AQPTTTPTPT PSTTTTTPTS        60
     PTPTETTAER VTPSSTVPSS PPASPSGTVP AVESTPEASA APDVTTPAPS GSAQTDSSAP       120
     TTTPSESTTP SSAPANGKKI PYTGLPTENP NATIVPGKMR SDREELPEGF TKEDADKAEM       180
     KEAELQKQAS GLRAAVAPGC QVYWPSDFQV CGAIRDKYNS LGAQFSFLGF PTTNELTNPD       240
     GFGRRSVFVN GPIYWSAASG AHPVVNHFFA AWQRNNWETG PLGYPTTDEI VNPDGLGRRQ       300
     EFQNTAAIYW KLNEAWAIRG AIRDKWNTVN AERPGSLLGY PLSDEIVLPD GQGRMNRFER       360
     GVLYWHPSHG AHPVVSGILD QWTASGYETG AYGYPTADEV TLQDIARQQQ FQNGILYSPK       420
     RVAADAAYKD YMQAPAAAQC AAPLGSRVGA WTCTKAGGAA AALPAPPQFN GPGEYCDVNF       480
     GGCWNVYDDF RADYQGDVVF GAGPQIIGNG SVVVEWKLAG PYTQITRATV SSNDAVMGRV       540
     VFAGALQNGA VGVANGGSLI HSTQPQFAPG PHMTGRAVGL PNPSGMELED RRMRDHNYVV       600
     QISVEFSEWP GYWYFYVRSP VAHYDDDDPN DIYRFMGADQ LPGNPVGGDW KW               652
//

If you have problems or comments...

PBIL Back to PBIL home page