(data stored in ACNUC7421 zone)

EMBL: CP000431.PE119

CP000431.PE119       Location/Qualifiers
FT   CDS             120244..120813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91955"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI1"
FT                   /protein_id="ABG91955.1"
FT                   /translation="MELVPQPPPDDDEFVYELTERQRRAIMATAAVLAATAYGDTEALG
FT                   DQVIESEDHGSLLAALPPCTWGQDASWRRQMARAFDDLAGDITAGTDPEPTCTGEEMAL
FT                   HIILTRASSDHLAGHLDQMLAKAPAHDNDTDWAAPTSFLFQDHDVLTLYDEDGVPVRDG
FT                   VNLEPEDWFLPFGDAVARDPGRGFRF"
     MELVPQPPPD DDEFVYELTE RQRRAIMATA AVLAATAYGD TEALGDQVIE SEDHGSLLAA        60
     LPPCTWGQDA SWRRQMARAF DDLAGDITAG TDPEPTCTGE EMALHIILTR ASSDHLAGHL       120
     DQMLAKAPAH DNDTDWAAPT SFLFQDHDVL TLYDEDGVPV RDGVNLEPED WFLPFGDAVA       180
     RDPGRGFRF                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page