(data stored in ACNUC7421 zone)

EMBL: CP000431.PE121

CP000431.PE121       Location/Qualifiers
FT   CDS             complement(124505..125488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00121"
FT                   /product="probable magnesium and cobalt transport protein"
FT                   /note="tc: 1.A.35; GO_function: GO:0015082 - di-,
FT                   tri-valent inorganic cation transporter activity;
FT                   GO_function: GO:0046873 - metal ion transporter activity;
FT                   GO_process: GO:0030001 - metal ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91957"
FT                   /db_xref="GOA:Q0SKH9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91957.1"
FT                   /translation="MDVRFISRDDVRSCAVTELRALLDRPDGLVWVDVPTWDEQANDAL
FT                   TTIFGFHPLAVRDSMNRNQVPKVHRYEDHFFVVLHAPQSGAHGHVHYVELDQFIGGRYL
FT                   VTVHGPVNPAIDPATAMVEVNAVLGRLKSGKLQPSNAFELSFAVLAALTARMRAYTAEL
FT                   TKDVWKLEQQVTGGHLGNPETFLDEMFRVRHGLLTVGTMAALSREVYGRMVTIEAFGAG
FT                   KGQDLLLDAVDQFQHLTVMAKGQKDYLQGTIEFYQARTNTKMTIAAERLAVIAAVTLPI
FT                   TALSSIIGMNVIVNERTQWLSVAAIVLVMLAMSGALLVWAKRKGWF"
     MDVRFISRDD VRSCAVTELR ALLDRPDGLV WVDVPTWDEQ ANDALTTIFG FHPLAVRDSM        60
     NRNQVPKVHR YEDHFFVVLH APQSGAHGHV HYVELDQFIG GRYLVTVHGP VNPAIDPATA       120
     MVEVNAVLGR LKSGKLQPSN AFELSFAVLA ALTARMRAYT AELTKDVWKL EQQVTGGHLG       180
     NPETFLDEMF RVRHGLLTVG TMAALSREVY GRMVTIEAFG AGKGQDLLLD AVDQFQHLTV       240
     MAKGQKDYLQ GTIEFYQART NTKMTIAAER LAVIAAVTLP ITALSSIIGM NVIVNERTQW       300
     LSVAAIVLVM LAMSGALLVW AKRKGWF                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page