(data stored in ACNUC7421 zone)

EMBL: CP000431.PE122

CP000431.PE122       Location/Qualifiers
FT   CDS             125574..125984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91958"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91958.1"
FT                   /translation="MVDDKIALVVVDAANVVGSRPDGWWRDRAGAARQLLAKLGTLEQR
FT                   LDRPAEVVVVLEGAAKAAVTGETNPEFEGLHVVSAPGSGDDAIVDVVAAAAEEDGDRPI
FT                   TVVTADRELRDRVEALGATTIGPRWLLDRINT"
     MVDDKIALVV VDAANVVGSR PDGWWRDRAG AARQLLAKLG TLEQRLDRPA EVVVVLEGAA        60
     KAAVTGETNP EFEGLHVVSA PGSGDDAIVD VVAAAAEEDG DRPITVVTAD RELRDRVEAL       120
     GATTIGPRWL LDRINT                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page