(data stored in ACNUC7421 zone)

EMBL: CP000431.PE126

CP000431.PE126       Location/Qualifiers
FT   CDS             130535..130804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91962"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91962.1"
FT                   /translation="MSAVSKAMYKPLALAASVAGGIAASALFGQVWKRVAGEAEAPDPK
FT                   DLSRSTREVLIAAAVQGTVFGLVKAAVDRAGAQGYRKLAHDDPR"
     MSAVSKAMYK PLALAASVAG GIAASALFGQ VWKRVAGEAE APDPKDLSRS TREVLIAAAV        60
     QGTVFGLVKA AVDRAGAQGY RKLAHDDPR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page