(data stored in ACNUC7421 zone)

EMBL: CP000431.PE129

CP000431.PE129       Location/Qualifiers
FT   CDS             complement(132116..132889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91965"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH1"
FT                   /protein_id="ABG91965.1"
FT                   /translation="MDNGTRFREISVAARGTPEDEWQSWLESTRFLPVPLAECDRLVVV
FT                   APHPDDEVLGVGALMATAAAAGIPVVVVAVTDGAASHPDSPTLSPDALAVARIAESTQA
FT                   TALLGAGEPLRLGIPDGGVSAHEHELTTRLVDVLTATSGAGERVWVLATWRDDGHPDHE
FT                   ATGRAAAAACSITGHRLIEYPVWMWHWARPADPAVPWNRIRVLTPAAEILARKRGAVDE
FT                   FRTQILPLSEDPRDAAILPPWVLARLMRTTEWVLW"
     MDNGTRFREI SVAARGTPED EWQSWLESTR FLPVPLAECD RLVVVAPHPD DEVLGVGALM        60
     ATAAAAGIPV VVVAVTDGAA SHPDSPTLSP DALAVARIAE STQATALLGA GEPLRLGIPD       120
     GGVSAHEHEL TTRLVDVLTA TSGAGERVWV LATWRDDGHP DHEATGRAAA AACSITGHRL       180
     IEYPVWMWHW ARPADPAVPW NRIRVLTPAA EILARKRGAV DEFRTQILPL SEDPRDAAIL       240
     PPWVLARLMR TTEWVLW                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page