(data stored in ACNUC7421 zone)

EMBL: CP000431.PE132

CP000431.PE132       Location/Qualifiers
FT   CDS             complement(134575..135066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00132"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0001760 -
FT                   aminocarboxymuconate-semialdehyde decarboxylase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91968"
FT                   /db_xref="GOA:Q0SKG8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG8"
FT                   /protein_id="ABG91968.1"
FT                   /translation="MAPLVCGFDPTDRPRGRIEFVWNRTGRWAGVGEVMFRHDDLTSLT
FT                   VGEVPSPDHAAMDDVLDFCSEKEVPISIHHDSASMGLPGRHEYIGALERALERHRSTSV
FT                   VWCHAGVSRRVGPNGQLDLVRELLLRHPNLTVELSWVLLDRIVDGPDVAVGNAERSWFP
FT                   "
     MAPLVCGFDP TDRPRGRIEF VWNRTGRWAG VGEVMFRHDD LTSLTVGEVP SPDHAAMDDV        60
     LDFCSEKEVP ISIHHDSASM GLPGRHEYIG ALERALERHR STSVVWCHAG VSRRVGPNGQ       120
     LDLVRELLLR HPNLTVELSW VLLDRIVDGP DVAVGNAERS WFP                         163
//

If you have problems or comments...

PBIL Back to PBIL home page