(data stored in ACNUC7421 zone)

EMBL: CP000431.PE136

CP000431.PE136       Location/Qualifiers
FT   CDS             complement(138952..139272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91972"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG4"
FT                   /protein_id="ABG91972.1"
FT                   /translation="MTTQTTEEPEEAFGTDWLRLALRRCDLLAQMHSVSSDARWMISFA
FT                   IQWAPFGGASAAELLERFGVSRRRFMELVFEGLAPKSTDVQKIRAMKSHLRTSLAQAWG
FT                   VQ"
     MTTQTTEEPE EAFGTDWLRL ALRRCDLLAQ MHSVSSDARW MISFAIQWAP FGGASAAELL        60
     ERFGVSRRRF MELVFEGLAP KSTDVQKIRA MKSHLRTSLA QAWGVQ                      106
//

If you have problems or comments...

PBIL Back to PBIL home page