(data stored in ACNUC7421 zone)

EMBL: CP000431.PE137

CP000431.PE137       Location/Qualifiers
FT   CDS             complement(139278..139739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91973"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91973.1"
FT                   /translation="MSCVDRGKPNGRRRGGAGIHGGDGMTTDGMTRWQGLAQKCELMIQ
FT                   RCLNCTTLLAPLMATCSACQGSNLERVPSCGVGSIVSSKVVHREVNETDRGLVPCTIAI
FT                   VELDEGPWVYTWIDGDVPAPSDCPVRVEFRPASTAEQLPVFAVRSAGQR"
     MSCVDRGKPN GRRRGGAGIH GGDGMTTDGM TRWQGLAQKC ELMIQRCLNC TTLLAPLMAT        60
     CSACQGSNLE RVPSCGVGSI VSSKVVHREV NETDRGLVPC TIAIVELDEG PWVYTWIDGD       120
     VPAPSDCPVR VEFRPASTAE QLPVFAVRSA GQR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page