(data stored in ACNUC7421 zone)

EMBL: CP000431.PE138

CP000431.PE138       Location/Qualifiers
FT   CDS             complement(139944..142301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00138"
FT                   /product="possible protein kinase/ transcriptional
FT                   regulator, LuxR family protein"
FT                   /note="bifunctional; GO_component: GO:0005622 -
FT                   intracellular; GO_function: GO:0003700 - transcription
FT                   factor activity; GO_function: GO:0004383 - guanylate
FT                   cyclase activity; GO_function: GO:0004674 - protein
FT                   serine/threonine kinase activity; GO_function: GO:0004713 -
FT                   protein-tyrosine kinase activity; GO_function: GO:0005524 -
FT                   ATP binding; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0006468 -
FT                   protein amino acid phosphorylation; GO_process: GO:0007242
FT                   - intracellular signaling cascade; GO_process: GO:0042829 -
FT                   defense response to pathogen"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91974"
FT                   /db_xref="GOA:Q0SKG2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG2"
FT                   /protein_id="ABG91974.1"
FT                   /translation="MRRGLRVESDGAMPAAVKGTVGNLPHELTSFVGRRREVTEARRLL
FT                   SVSRLVTLAGIGGVGKTRLALRVAADASRAFEDGVWLVELGELDDDTTLVDAVSAALRL
FT                   REQRSGNPEVLLTEYLATRQLLLVLDNCEHVVAAAAALSETLLRGCPELRILATSREPL
FT                   AIGGEAVLRVPPLTVPEPERSSLQGLPQYEAVTLFVERAATAVPEFELTEDNHVAVARI
FT                   CRQLDGLPLAIELAAVRLRVMSAEQILQRLTDRYRLLTVGSRGAPSRQQTLRLCVDWSH
FT                   ELCTEEERELWARLSVFAGGFELDAVEGICAGDLPVENVLDVVASLIDKSILIREESGP
FT                   AVRYHLLETVRDYGREKLQETGEYQSLRRRHRDWYEQLVVQCEAEWIGPRQAMWISRLD
FT                   AETLNVRAALHFCLTEPGEAETGLRIAAALYPYWRARGLLREGRRWLGQLLGRHPGGAS
FT                   RERIEALYVDSVLAGMHGDREAAKALVDEGVLLAERHGDTLMRALVVHAAGCCAMFAGD
FT                   LPRARVCFEEALAEFRDKGNLLQLTWGLLGVALVSGMQGDGAVAKMCGSEIFALTEAHG
FT                   ESVYRGWSLWAAGMAAWQRGHLALADDYVKQGLRLSHLVDDRISACGALEVLAWVAVGS
FT                   GRAQQAAELMGAAEAVAQTVGNPSTVYPNLLVHHAECEQQARAVIGDRAFDDAFDHGMR
FT                   TSFDDAVAHALDEQPPETVSASNGATHLTRREWQVAELVADGLTNKAIAARLVISQRTA
FT                   QGHVEHILAKLGFNSRTQIAAWIVEHAQDPHP"
     MRRGLRVESD GAMPAAVKGT VGNLPHELTS FVGRRREVTE ARRLLSVSRL VTLAGIGGVG        60
     KTRLALRVAA DASRAFEDGV WLVELGELDD DTTLVDAVSA ALRLREQRSG NPEVLLTEYL       120
     ATRQLLLVLD NCEHVVAAAA ALSETLLRGC PELRILATSR EPLAIGGEAV LRVPPLTVPE       180
     PERSSLQGLP QYEAVTLFVE RAATAVPEFE LTEDNHVAVA RICRQLDGLP LAIELAAVRL       240
     RVMSAEQILQ RLTDRYRLLT VGSRGAPSRQ QTLRLCVDWS HELCTEEERE LWARLSVFAG       300
     GFELDAVEGI CAGDLPVENV LDVVASLIDK SILIREESGP AVRYHLLETV RDYGREKLQE       360
     TGEYQSLRRR HRDWYEQLVV QCEAEWIGPR QAMWISRLDA ETLNVRAALH FCLTEPGEAE       420
     TGLRIAAALY PYWRARGLLR EGRRWLGQLL GRHPGGASRE RIEALYVDSV LAGMHGDREA       480
     AKALVDEGVL LAERHGDTLM RALVVHAAGC CAMFAGDLPR ARVCFEEALA EFRDKGNLLQ       540
     LTWGLLGVAL VSGMQGDGAV AKMCGSEIFA LTEAHGESVY RGWSLWAAGM AAWQRGHLAL       600
     ADDYVKQGLR LSHLVDDRIS ACGALEVLAW VAVGSGRAQQ AAELMGAAEA VAQTVGNPST       660
     VYPNLLVHHA ECEQQARAVI GDRAFDDAFD HGMRTSFDDA VAHALDEQPP ETVSASNGAT       720
     HLTRREWQVA ELVADGLTNK AIAARLVISQ RTAQGHVEHI LAKLGFNSRT QIAAWIVEHA       780
     QDPHP                                                                   785
//

If you have problems or comments...

PBIL Back to PBIL home page