(data stored in ACNUC7421 zone)

EMBL: CP000431.PE141

CP000431.PE141       Location/Qualifiers
FT   CDS             complement(144521..171307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00141"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.3"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91977"
FT                   /db_xref="GOA:Q0SKF9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF9"
FT                   /protein_id="ABG91977.1"
FT                   /translation="MTSVNSPQPNNGAEDVTVPEGAFPLSSVQRSMWFAQQLSPTVPKF
FT                   IAQYIELRGEIDLDLLSDAAVRAGQEFQSPFLRLLDVDGEPYQAVDFSIDPSIGFLDFR
FT                   GESDPMGAAQVWIDEDYATPLRLTRDRLVEMTVLQVGEQHYLWYTRIHHVALDGYSGMT
FT                   MVNRIAALYTAAVEGTEPEPNRALDLRDLYELDQKYRASSRFENDRLYWAERIVGIEHG
FT                   STLATHDAPAAAKSRLESAKISDTALGFLGESDQRVGATSAAVLLAGFACYLSRMTGKR
FT                   DVLINLPVSARTTAPLQRSGGMLVNVAPLRITVRPEDTVAELVQRTQLELMGALRHQRC
FT                   SLEDIRRDAGLAGTAEGLAGPMVNVMLFHQAFTLGTVTGEYHIVTSGPVDDLLVNIYQS
FT                   GDGQTLLDFRGNPNRYGSEELRAHHRRFVELVEEFVTAEPQTRTADIHAESARLGARFL
FT                   EREAQLAFWKRELAGLPEVAALPLDRPRPAERAGAGEVVGFAVDAEVQRRAALLAEEAG
FT                   TGIFTALHAALAVLLGRLGDTDDVVIGTPIVGREAADSDDPEAGAFFNKTVLRSQVDTA
FT                   SSFVDHLSRVRDADRAAFTHAALPFDDLVAALGAESDPSHTPLFQVMLEFTDGGHPHDS
FT                   SGNVTVSPIQREHRALGLDLVFSLTESESGGINGRLRFATDVWDRASAEALAARFVRIL
FT                   QTVTAEPTAPIGDVDLLEQVEYAELAPVRDEPSVEPRTLPTLLARAVEAGGDGDALVYQ
FT                   GRTLTYPELDAQSDRLARMLIGHGVGPGSVVALAIARSIESVLATWAVAKSGAAFVPVD
FT                   PNYPADRIEHMLTDSGAVVGLTVAAHRSSLPETTPWLVMDDASFGRDLAQHAAGTVADA
FT                   DRLRPLRTADPAYLIYTSGSTGTPKGVVVTHAGLANFAEDERQRFAVTAGSRTLHFSSP
FT                   SFDASILELLLAVGAGATMVVAPSTVYGGTELADLLSRERVTHAFVTPAALASVDPTGL
FT                   DHIRCVVTGGESCPPALVAQWAPGRVMFNAYGPTEATVVASVAGPLTVGEPVTIGRPSR
FT                   GCGLLVLDSRLHPVPRGVPGELYITGDGVARGYHNRSIPTAERFVADPHGAPGERMYRT
FT                   GDLARWNAAGQLEYLGRTDFQVKIRGFRIELGEIDAVVRSHPSVAFATTVGRTAPSGDT
FT                   VLVTYVLPEDGTDIVVGDILEHAAAALPAHMVPARVMVLREVPLTPAGKLDRKALPEPQ
FT                   FEATSTVYRAPVTPTEMQIAEVFAALLGVERIGVDDSFFDLGGDSLVATRVVSRVNAAL
FT                   STEIGVLDLFEAPSVALLSARVDALGPRTSARPVLAPRAGSGPVQVSLAQQRMWFINQL
FT                   DTASPAYNIPVGIRLRGTLDVEALRTAVSDVLTRHESLRTVFPNTPNGPIQVVLPVAEV
FT                   SPHLDAVEVAENELESRLIADAATGFDVTVEPPIRAELYRTATDDHVLVFVVHHIAADG
FT                   LSMTPLTRDVMVAYHARAAGDTPQWAPLEVQYADFAVWQRELLGSPDDPTSLLARQLAF
FT                   WARTLDGAPEVMDLPTDRPRPARQSMIGATADFSIPARIHAALLEIAGANDASLFMVVH
FT                   AALAVLLSRSSGSSDVSIGSPVSGRGERQLDDVVGMFVNTVVLRTTVDPDRSFPEILSH
FT                   TRSVDLAAFSNTDLPYERLVDELKPTRSEAHSPLFQVMLVLQGFANTRLELPGLDVEVE
FT                   ALETGAAKFDLQVILTEHTEESGAPGAIDVQFSYASELFDPPTMTALAERFVTLLETIT
FT                   AGSDAKVGDIDLIGADETHRMLEQWIDTDVAVPDSATLVSLFEAQVARTPDAVAVVFAE
FT                   EELLYAEFDARANRLARELLARGVGPESRVAVALRRSLELMIAIYAVEKTGAAYVPLDP
FT                   DHPASRIAYVIESAEPACVLTSSRDRCEGVDSAAGAAVIEIDTLNLSRRPSTPITAAER
FT                   GGPIHPDSTAYVIYTSGSTGRPKGVAVSHRAIVNRLLWMQDTYRMDHTDVVLQKTPVTF
FT                   DVSVWELFWPLEVGARLVLAAPDGHRDPTYLSHIIADHQVTTMHFVPSMLAVFTAGAEP
FT                   ELCGSLRQVFCSGEALPPATADAFREFGSAALHNLYGPTEAAVDVTYWECTEGDRASVP
FT                   IGAPVWNTQVYVLDSRLHPVPVGVHGELYLAGIQLARGYVGRSDLTSDRFVANPFGAPG
FT                   QRMYRTGDVVRWRADGNIEYIGRRDFQVKLRGQRIELGEVEAAVLAHPSVAQAVVTVHR
FT                   SEATGESLVGYVIPVAGADIDTAVVRDAAAEALPAYMVPTRIIVLDRFPLGATGKLDRG
FT                   ALPEPEFLSPSAEFVTPRNPIEEILASIFADLLDAPRIGVYDSFFDLGGNSLVATRLVA
FT                   RVNAALGSRIGVREIFDAPTVATLATRIESEAVQGAERPPLVAGARPDRLPVSLAQKRM
FT                   WFINQFDLDSPAYNIALAVRLTGDLDEDAMQDAVADVMDRHESLRTRFPMVEGEPVQVI
FT                   LPTEDVVPDLSPIATTEAELPEHISRLAGAGFDVTVSVPVRAALFRTDPGEHVLVIVVH
FT                   HISADGFSMAPLARDVMTAYAARTGGQAPDWTPLPVQYADFALWQHRVLGNADDPDSLL
FT                   AAQLDYWTHTLAGLPELLALPTDHPRPTQQSMRGGIHSFSIDPQVHSRLITTAREHNSS
FT                   VFMAVHAALAVLLARLGDTDDVSVGTPIAGRGDAALDDMVGMFVNTLVLRTPVEPAGTF
FT                   TDLLSTVRDTDLNAFHHADLPFERLVDAISPERATSHSPLFQVVLEFRNNERPRLELPG
FT                   LTVTGLDLATDISNFDLQLTLTEEFGASGEPAGISAAFTYASSLFDASTIAGFADYLQR
FT                   IFDAVTSEPGMAVGDIDLMVASERAALTPVMDGPDAEPRTLPELLAAAASVDPKAAALS
FT                   YEGREVTYRDLDERSNRLARLLIGRGIGPESVVALALARSPESVLSLWAVAKTGAAFVP
FT                   VDPNYPTDRIVHMLSDSGAALALTVAEFRPTLPDCTSYVVVDAPGFDDEVSAHSAAVVT
FT                   DADRTHPLALENPAYLIYTSGSTGTPKGVVVTHRGLANFATDERVRFGVTPRSRTLHFS
FT                   SPSFDASILELLLAVGSGATMVIAPASVIGGTELADVLREGRVTHAFITPAAMASVDPA
FT                   GLDQLECVATGGDVCPPELVAQWVTGGRRMFNAYGPTEATVVSSVTGPMIPGEGVTIGR
FT                   PPMGTGEMVLDSRLHPVPNGVTGELYVSGSGLARGYKDRAGTTAERFVANPYGGLGARM
FT                   YRTGDLARWNGAGQLEYLGRSDFQVKIRGFRIELGEIETALTRYPGVARSVVSAHRGST
FT                   GANRLVGYLVPTAGAELDPEAVLEFVGGFLAPYMVPSALIVLDELPLTPAGKLDRRALP
FT                   EPDFGARVSTGRAPVSEMEEVLAGLFAEVLGLESAGVEDSFFALGGDSIMSIQLVARAK
FT                   AAGVVLTPRDVFEAKTVAGLAAVASWVGAADVVVLDELPGGGVGDMPTTPITKWLLERG
FT                   GEFNRMSQSALLTAPPNLRELEPLSATFQAVLDRHDMLRAQLIVSAEDSHLAVRPVGEV
FT                   DAQDLIRRVPVSTAPGTRAFAATVIAELDAALDRLDPAAGVMVQVVWFDAGESGGRLLV
FT                   VAHHLVVDGVSWRILVPDLATAWAQISAGQEPVLEQVGTSMRRWAHGLVDEAASRAGEL
FT                   DLWQRILDCEDPLVGSRPLDPDIDVNATVGRVTVQLPAEVSEAVLTALPEAIHGSVNDG
FT                   LLTALAMAVTQWRRTRGHTLHGRSVDGTLVSLEGHGREDQVVPGADLGRTVGWFTAMFP
FT                   VRLDLSGIDLDDAFDGGKAAGSAIKAIKEQLLAIPDHGMGYGMLRYLNADTAPLLAARS
FT                   LPQISFNYLGRFAADLSEAATRAGWTPTGEVDMDRAQDLDTPVTSAIDVNAVTTEVEDR
FT                   PQLRATWAYAAGVLTVAEVRELAELWVRALTALTTYAARPDAGGVTPSDLELVSLDQDA
FT                   IDRIESRFPALSDIWSLSPLQSGLLFHALLADQTIDSYTVQVTLELRGAVPSRMRVAGQ
FT                   ALLDRHANLRASFVYDEGGTPVQAIHGSAELPWTEIDLSGLDAESREAEIVRLLDADRR
FT                   RGFDMATPPLLRFMLIQIGGDEQRLIITNHHILLDGWSMPLLIRDLLTLYATEGDATAL
FT                   PRVHPYRDYLAWMSHRSTEDSLGVWQRALAGVEEPTLLAPADASVQSDTQSSELLVELD
FT                   VDRTDQLSVLAREHGLTLSTLIRTAWGIVLGGLVGRSDVVFGGTVSGRPPQIAGIESMV
FT                   GLFINTLPVRVVLDPRETLGELLERIQGEQAALLDHHYVGLTDIQSVAGPGAGFDTLTV
FT                   FESYPVDREGLTDQTDIAGMHVLDVHDSANAAHYPLALIASAHENLQLKLEYVEELFDR
FT                   ADVERIGDRIVRALIALAEHPGMKLAQLRLLTDVEEAELVPARGLPGRSVRTLPQMFAE
FT                   TAAAAGDATALVFGDRRMSYRELDERSNQLARLLIDRGVGPEDIVALGISRSIESVLAV
FT                   WSITKTGAAFVPVDPTYPRERVEHMVTDSGCTFGLRLEADHGRLPDTVRWLTLDDTETA
FT                   TAIRAMSTDTVTDDDRVAPLRFAHPAYVIYTSGSTGKPKGVVVSHRGLDNFAEEQRTRY
FT                   ATDSTSRALHFSSPSFDASVLEYLLSFAVGATMVIVPPSVYGGEELAELIRTEGVTHGF
FT                   VTPAALASVDPEGLEVFQNVVAGGEAVPPELVTRWAPGRTMYNGYGPTETTIMSNLSDH
FT                   LQVGETVTIGAPVRGVSEVILDSRLQPVSVGVAGELYISGEGLARGYHARAGLTSERFV
FT                   ANPYGEPGDRMYRTGDLARWRSDHTVEYLGRTDFQVKIRGFRIELGDIDSALAAHPSVA
FT                   FAVTLGRPGPAGDTVLVSYVLPEAESALEPPELKEWTANLLPAHMVPSSIMILDEIPLT
FT                   PVGKLDRAALPEPQFLPTSDDFRPPSTVLEHTIADVITTVLGIERVGIDDNFFDIGGNS
FT                   LIATRVAARLTAELDTDIGVRTLFEAPTIHQLARLIESTAFAPAQDGAHVRIPLGPMPR
FT                   PAHVPVSLAQKRMWFLNQFDTSSAAYNIPLAVRLTGHLDVESLRAAVTDVFVRHESLRT
FT                   VFPSHDGEPTQVVLSPGQWTPNLEIVEVSEDELREHIAGLATAGFDVTADVPMRSALFA
FT                   LAPDDHVLVIVVHHICADGFSLTPLARDVMTAYAARIAGSAPQWNPLSVQYADYTLWQL
FT                   QLLGDESDAESLISQQLRYWTDQLADLPELLQLPTDRARPVQQSFRGAQVDFTIPADVH
FT                   RALAALARKHNSTMFMAVHAALSVLLSALSSTEDIAVGTPIAGRGDAALDDMVGMFVNT
FT                   LVLRSAVDPAAGFGALMDQVRSTDLAAFHHSDLPFERLVDVLAPERSTAHSPLFQALLE
FT                   FRNNETPRLELPELTAAAVDFDLEVAKFDLQLSVEEGFDADGVASGIAASFIFATDLFD
FT                   AGTVRTFADRFLRILGAVTSDPLAPVGDIVITDAAERSAMATEWNTAGFDAGTDTLADR
FT                   FAQSVARFPDATAVTSEDVALTYAELDARSNRLARLLISQGVGPETLVAVALPRTCDLI
FT                   IALLAVIKTGGGYLPVDITYPADRLAFVFEDAAPNCVITTTGDVSALPDSETPAILLDD
FT                   PETTADLAQQSPATITDADRVTPLDSSSVAYVIYTSGSTGRPKGVVVSHRNVLTLFANT
FT                   QPLYGFDENDVWTMFHSYAFDFSVWELWGPLLYGGRLVVVDYYTARSPEMFHELLRNEQ
FT                   VTVLNQTPTAFYQLAETDRIVSEIDVNAAALALRYVIFGGEALDLGQLGRWYSRHDDSA
FT                   PTLVNMYGITETTVHVSYLALDREFAESASASVIGRGIAGLHVHVLDRRLHPVPPGTIG
FT                   EMYVSGDQVTRGYLGRAGLSSSRFVADPLRPGARMYRTGDLARWNTDGQLEYLGRSDFQ
FT                   VKIRGFRIELGEIESALLRYRGIAQAVVLTRDDGHGGHRLIGYVVPESGATVEVSSALE
FT                   FVGTQLTSYMVPATLVVLDALPLTSNGKLDRRALPEPDFGARVSAGRAPATEMETVLAG
FT                   LFAEVLGLESVGVDDSFFALGGDSIMSIQLVARAKAAGVVLTPRDVFEAKTVAALAEAA
FT                   SWAGAADVVVLDELPGGGIGEMPVTPITAWLLERGGDFRRYTQTALLSLPAAADETLLK
FT                   RTIAAVVDHHDMLRARLLGAEPQWRIEVQAVGVVDVDDVLHRVEVASVVGSGFAEVATR
FT                   ELDAAAGRLDPEAGVMLQMVWFDAGDQGGRLLVVAHHLVVDGVSWRILVPDLATAWAQV
FT                   SAGQEPTLEPVGTSMRRWSHGLVEATRERAGEIELWRRVLEADDPLIGSRPLDAAIDVA
FT                   GTVEKVTVEVPADVTDALLTRVPEAFHGGVNDGLLTALALALAQWRRTHGDFTRESLVS
FT                   LEGHGREDQVLPGADLGRTVGWFTAMFPVRLDLSGIDLDDAFAGGKATGSAVKAIKEQL
FT                   LAIPDHGIGYGMLRYLDPESADQLRALAKPQVTFNYLGRLGGATSTDIHGHAWVPVTDT
FT                   KLDDIPASDIPVASALDINAVTGTGADGNRLRATWAFPTGVLTPSEVRALADLWVQALT
FT                   ALTTHVARPDAGGVTPSDLDLVTLDQDAIDRLEARFPALSDIWSLSPLQSGLLFHAQFS
FT                   DASVDPYLVQLALKLRGNIDPDRIRRAGQALLDRHPNLRAAFVHDSAGASAQIIQQHVE
FT                   LPWSEFDLSALDPDETTREYDRIVARDRSVKFDMANAPLLRLALVRLTEEDYRLILTNH
FT                   HILLDGWSTPLVIRDLLTLYALDADGSLLPRVHSYRDYLSWMKRHDTTDSLDAWRTALD
FT                   GVEEPTLLAPLERGEAHSAVAEETAFTLSEEQTTRLRDLSRERGLTLNTVVQTAWGIVL
FT                   GGLVGRSDVVFGGTVSGRPPQIAGIESMVGLFINTLPVRVTLDPWESLGELLERVQSEQ
FT                   AALLDHHYVGLTDIQSAVGGGGAFDTLTVFESYPVDEAGLTEQTDIAGMFVTGIDGKDS
FT                   AHYPLAVVASGDARLNFKFEYLPEVFEESAVDEIADRLQRVLDALADRPEIPLAHMQLL
FT                   TEAELAEFAPVRGRPGFSVRTLPQIFEDAAALDPNRTALTFEGRNVSYRELNERSNQLA
FT                   RVLISRGAGPETFVALGIPRSIESVLAVWAVAKTGAAFVPVDPNYPMDRIEHMLTDSGA
FT                   TIGLTMAAYEKALPDSVPWLQLDSPKFEKACQSKPALPVADSDRRSPISLDNAAYIVYT
FT                   SGSTGKPKGVVVTHEGLDNFAEDQRQRFAAAQTSRTLHFSTPSFDGSVFEYLQAFGVGA
FT                   TMVIAPPTVYGGAELAELIRSEHVTHAFVTTAALSTVDPTGLDEFQHVVFGGEACPPEL
FT                   VTRWAPGRQLSNAYGPTETTVMANISDPMTVGDPITLGGPIRGVGELVLDSRLQPVPVG
FT                   VPGELYITGAGLARGYHRRPELSSQRFVANPFGEAGERMYRTGDIVRWRADHTVEYVGR
FT                   SDFQVKIRGFRIELGEIDNEIATFPGVSFAATLGVPGPSGDTVLVTYLLPNTAGGVDPA
FT                   ELTAHLSTRLPAHMVPTSVMFLDEIPLTPVGKLDRSALPAPEFHVTTTEFQPPTNDLER
FT                   KIVDIFADVLGIERIGIDDNFFDLGGNSLVATRVTARLRDALDTDIGVRALFEAPDVRS
FT                   LAARVADSVSGGARPALAPVERPDRIPLSLAQKRMWFLNQFDTSSPAYNIPLAVRLTGT
FT                   LDEDALRLAMADVLERHETLRTVFPTVDNEPTQRILPAADAQPGVDTVSVAAEDLPRHI
FT                   MDLVSRGFDVSTDVPVRAALFRIAPDHHVLTIVVHHISADGFSLAPLARDVMVAYTSRL
FT                   GGDGPQWDPLHVQYADYTLWQHAGLGSENDPESMINQQLRFWSETLAGVPDVIQLPTDR
FT                   PRPIQQTFEGDRVEFAIDADLHQRLTALARANNATMFMAVHAALAVLLSRLGSTDDVVI
FT                   GTPVAGRGEAALDDMVGMFVNTLVLRNRIDPASTFTELVQRIRETDLAAFQHSDLPFER
FT                   LVEELNPTRSTSYSPLFQVALEFQNNENPTLELPDLRVENVDLETKVVKEDLEVILAEQ
FT                   FDQDGAPAGVAGGLDFAVSLFDRGTARSIADRFVRILAAVTADPDRPIGTLPLLDEAEI
FT                   EEMVPARGKPDVRPEVWPDLLTAAAALDPDSVALSFEDRQVTYRELDEWSNRLARVLCA
FT                   QGVGPETFVAIGMPRSIEEVVSIWSVAKSGAAFVPVDPTYPRDRIDYMLTDCRASVGLT
FT                   VAGRRDNLPDTVPWLVLDDESFAEQVAAVSSSPVTDADRTRPLHLAHPAYLIYTSGSTG
FT                   KPKGVIVTHRGMANLTAEEHERFQVTHESRVSHLASPSFDASIFELMMAFGASARVVIV
FT                   PPTVFGGTELADLFRRNAVTHAFITPTALSSIEDVGLESLRVLAVAGEACPPELVEIWG
FT                   KHRNMHNGYGPTETTIQASVSAPMRPGGVVNIGAPALGFGSLVLDERLQPVPVGVPGEL
FT                   YITGPGLARGYHNRSALTSERFVACPFGEPGRRMYRTGDVVRWRGDHTIEYIGRTDFQV
FT                   KVRGFRIELGEIDAVLARHPAVAFAATIGHTGPSGDTLLASYVRAAEGHDLEPAELRTH
FT                   AADRLPAHMVPSAVVVLDQIPMTPVGKLDRKALPAPEFGTTGAAFRAPTTATERIIVEA
FT                   FAEVLGVDRVGTADSFFDLGGNSIVATRVITVLQERLGRQIPLQSMFLDPTPAGLALRV
FT                   DTENAAGSPVDEALGVVIPLRPTGDKPPLFCIHPGIGLSWGYAGLLQHLSQDRPAFGLQ
FT                   LPIISGGPSFESIEQLAHQYVLEMRKVQAHGPYHLLGWSLGGVIAHAMAVELRREGEAV
FT                   DTLAVMDSYVTGGTDQGPESLTVPELLHGLGLDLESVSGEELTYERAVELLDDAFGQKT
FT                   GLTPQHLERISAGFTNSSRIMNNFRPQVFDGDLLFFTAAGSASTDQHSPEEWRSSVTGG
FT                   IREVKIECEHNQMIEPEVLAVVGPVLEDYLSAH"
     MTSVNSPQPN NGAEDVTVPE GAFPLSSVQR SMWFAQQLSP TVPKFIAQYI ELRGEIDLDL        60
     LSDAAVRAGQ EFQSPFLRLL DVDGEPYQAV DFSIDPSIGF LDFRGESDPM GAAQVWIDED       120
     YATPLRLTRD RLVEMTVLQV GEQHYLWYTR IHHVALDGYS GMTMVNRIAA LYTAAVEGTE       180
     PEPNRALDLR DLYELDQKYR ASSRFENDRL YWAERIVGIE HGSTLATHDA PAAAKSRLES       240
     AKISDTALGF LGESDQRVGA TSAAVLLAGF ACYLSRMTGK RDVLINLPVS ARTTAPLQRS       300
     GGMLVNVAPL RITVRPEDTV AELVQRTQLE LMGALRHQRC SLEDIRRDAG LAGTAEGLAG       360
     PMVNVMLFHQ AFTLGTVTGE YHIVTSGPVD DLLVNIYQSG DGQTLLDFRG NPNRYGSEEL       420
     RAHHRRFVEL VEEFVTAEPQ TRTADIHAES ARLGARFLER EAQLAFWKRE LAGLPEVAAL       480
     PLDRPRPAER AGAGEVVGFA VDAEVQRRAA LLAEEAGTGI FTALHAALAV LLGRLGDTDD       540
     VVIGTPIVGR EAADSDDPEA GAFFNKTVLR SQVDTASSFV DHLSRVRDAD RAAFTHAALP       600
     FDDLVAALGA ESDPSHTPLF QVMLEFTDGG HPHDSSGNVT VSPIQREHRA LGLDLVFSLT       660
     ESESGGINGR LRFATDVWDR ASAEALAARF VRILQTVTAE PTAPIGDVDL LEQVEYAELA       720
     PVRDEPSVEP RTLPTLLARA VEAGGDGDAL VYQGRTLTYP ELDAQSDRLA RMLIGHGVGP       780
     GSVVALAIAR SIESVLATWA VAKSGAAFVP VDPNYPADRI EHMLTDSGAV VGLTVAAHRS       840
     SLPETTPWLV MDDASFGRDL AQHAAGTVAD ADRLRPLRTA DPAYLIYTSG STGTPKGVVV       900
     THAGLANFAE DERQRFAVTA GSRTLHFSSP SFDASILELL LAVGAGATMV VAPSTVYGGT       960
     ELADLLSRER VTHAFVTPAA LASVDPTGLD HIRCVVTGGE SCPPALVAQW APGRVMFNAY      1020
     GPTEATVVAS VAGPLTVGEP VTIGRPSRGC GLLVLDSRLH PVPRGVPGEL YITGDGVARG      1080
     YHNRSIPTAE RFVADPHGAP GERMYRTGDL ARWNAAGQLE YLGRTDFQVK IRGFRIELGE      1140
     IDAVVRSHPS VAFATTVGRT APSGDTVLVT YVLPEDGTDI VVGDILEHAA AALPAHMVPA      1200
     RVMVLREVPL TPAGKLDRKA LPEPQFEATS TVYRAPVTPT EMQIAEVFAA LLGVERIGVD      1260
     DSFFDLGGDS LVATRVVSRV NAALSTEIGV LDLFEAPSVA LLSARVDALG PRTSARPVLA      1320
     PRAGSGPVQV SLAQQRMWFI NQLDTASPAY NIPVGIRLRG TLDVEALRTA VSDVLTRHES      1380
     LRTVFPNTPN GPIQVVLPVA EVSPHLDAVE VAENELESRL IADAATGFDV TVEPPIRAEL      1440
     YRTATDDHVL VFVVHHIAAD GLSMTPLTRD VMVAYHARAA GDTPQWAPLE VQYADFAVWQ      1500
     RELLGSPDDP TSLLARQLAF WARTLDGAPE VMDLPTDRPR PARQSMIGAT ADFSIPARIH      1560
     AALLEIAGAN DASLFMVVHA ALAVLLSRSS GSSDVSIGSP VSGRGERQLD DVVGMFVNTV      1620
     VLRTTVDPDR SFPEILSHTR SVDLAAFSNT DLPYERLVDE LKPTRSEAHS PLFQVMLVLQ      1680
     GFANTRLELP GLDVEVEALE TGAAKFDLQV ILTEHTEESG APGAIDVQFS YASELFDPPT      1740
     MTALAERFVT LLETITAGSD AKVGDIDLIG ADETHRMLEQ WIDTDVAVPD SATLVSLFEA      1800
     QVARTPDAVA VVFAEEELLY AEFDARANRL ARELLARGVG PESRVAVALR RSLELMIAIY      1860
     AVEKTGAAYV PLDPDHPASR IAYVIESAEP ACVLTSSRDR CEGVDSAAGA AVIEIDTLNL      1920
     SRRPSTPITA AERGGPIHPD STAYVIYTSG STGRPKGVAV SHRAIVNRLL WMQDTYRMDH      1980
     TDVVLQKTPV TFDVSVWELF WPLEVGARLV LAAPDGHRDP TYLSHIIADH QVTTMHFVPS      2040
     MLAVFTAGAE PELCGSLRQV FCSGEALPPA TADAFREFGS AALHNLYGPT EAAVDVTYWE      2100
     CTEGDRASVP IGAPVWNTQV YVLDSRLHPV PVGVHGELYL AGIQLARGYV GRSDLTSDRF      2160
     VANPFGAPGQ RMYRTGDVVR WRADGNIEYI GRRDFQVKLR GQRIELGEVE AAVLAHPSVA      2220
     QAVVTVHRSE ATGESLVGYV IPVAGADIDT AVVRDAAAEA LPAYMVPTRI IVLDRFPLGA      2280
     TGKLDRGALP EPEFLSPSAE FVTPRNPIEE ILASIFADLL DAPRIGVYDS FFDLGGNSLV      2340
     ATRLVARVNA ALGSRIGVRE IFDAPTVATL ATRIESEAVQ GAERPPLVAG ARPDRLPVSL      2400
     AQKRMWFINQ FDLDSPAYNI ALAVRLTGDL DEDAMQDAVA DVMDRHESLR TRFPMVEGEP      2460
     VQVILPTEDV VPDLSPIATT EAELPEHISR LAGAGFDVTV SVPVRAALFR TDPGEHVLVI      2520
     VVHHISADGF SMAPLARDVM TAYAARTGGQ APDWTPLPVQ YADFALWQHR VLGNADDPDS      2580
     LLAAQLDYWT HTLAGLPELL ALPTDHPRPT QQSMRGGIHS FSIDPQVHSR LITTAREHNS      2640
     SVFMAVHAAL AVLLARLGDT DDVSVGTPIA GRGDAALDDM VGMFVNTLVL RTPVEPAGTF      2700
     TDLLSTVRDT DLNAFHHADL PFERLVDAIS PERATSHSPL FQVVLEFRNN ERPRLELPGL      2760
     TVTGLDLATD ISNFDLQLTL TEEFGASGEP AGISAAFTYA SSLFDASTIA GFADYLQRIF      2820
     DAVTSEPGMA VGDIDLMVAS ERAALTPVMD GPDAEPRTLP ELLAAAASVD PKAAALSYEG      2880
     REVTYRDLDE RSNRLARLLI GRGIGPESVV ALALARSPES VLSLWAVAKT GAAFVPVDPN      2940
     YPTDRIVHML SDSGAALALT VAEFRPTLPD CTSYVVVDAP GFDDEVSAHS AAVVTDADRT      3000
     HPLALENPAY LIYTSGSTGT PKGVVVTHRG LANFATDERV RFGVTPRSRT LHFSSPSFDA      3060
     SILELLLAVG SGATMVIAPA SVIGGTELAD VLREGRVTHA FITPAAMASV DPAGLDQLEC      3120
     VATGGDVCPP ELVAQWVTGG RRMFNAYGPT EATVVSSVTG PMIPGEGVTI GRPPMGTGEM      3180
     VLDSRLHPVP NGVTGELYVS GSGLARGYKD RAGTTAERFV ANPYGGLGAR MYRTGDLARW      3240
     NGAGQLEYLG RSDFQVKIRG FRIELGEIET ALTRYPGVAR SVVSAHRGST GANRLVGYLV      3300
     PTAGAELDPE AVLEFVGGFL APYMVPSALI VLDELPLTPA GKLDRRALPE PDFGARVSTG      3360
     RAPVSEMEEV LAGLFAEVLG LESAGVEDSF FALGGDSIMS IQLVARAKAA GVVLTPRDVF      3420
     EAKTVAGLAA VASWVGAADV VVLDELPGGG VGDMPTTPIT KWLLERGGEF NRMSQSALLT      3480
     APPNLRELEP LSATFQAVLD RHDMLRAQLI VSAEDSHLAV RPVGEVDAQD LIRRVPVSTA      3540
     PGTRAFAATV IAELDAALDR LDPAAGVMVQ VVWFDAGESG GRLLVVAHHL VVDGVSWRIL      3600
     VPDLATAWAQ ISAGQEPVLE QVGTSMRRWA HGLVDEAASR AGELDLWQRI LDCEDPLVGS      3660
     RPLDPDIDVN ATVGRVTVQL PAEVSEAVLT ALPEAIHGSV NDGLLTALAM AVTQWRRTRG      3720
     HTLHGRSVDG TLVSLEGHGR EDQVVPGADL GRTVGWFTAM FPVRLDLSGI DLDDAFDGGK      3780
     AAGSAIKAIK EQLLAIPDHG MGYGMLRYLN ADTAPLLAAR SLPQISFNYL GRFAADLSEA      3840
     ATRAGWTPTG EVDMDRAQDL DTPVTSAIDV NAVTTEVEDR PQLRATWAYA AGVLTVAEVR      3900
     ELAELWVRAL TALTTYAARP DAGGVTPSDL ELVSLDQDAI DRIESRFPAL SDIWSLSPLQ      3960
     SGLLFHALLA DQTIDSYTVQ VTLELRGAVP SRMRVAGQAL LDRHANLRAS FVYDEGGTPV      4020
     QAIHGSAELP WTEIDLSGLD AESREAEIVR LLDADRRRGF DMATPPLLRF MLIQIGGDEQ      4080
     RLIITNHHIL LDGWSMPLLI RDLLTLYATE GDATALPRVH PYRDYLAWMS HRSTEDSLGV      4140
     WQRALAGVEE PTLLAPADAS VQSDTQSSEL LVELDVDRTD QLSVLAREHG LTLSTLIRTA      4200
     WGIVLGGLVG RSDVVFGGTV SGRPPQIAGI ESMVGLFINT LPVRVVLDPR ETLGELLERI      4260
     QGEQAALLDH HYVGLTDIQS VAGPGAGFDT LTVFESYPVD REGLTDQTDI AGMHVLDVHD      4320
     SANAAHYPLA LIASAHENLQ LKLEYVEELF DRADVERIGD RIVRALIALA EHPGMKLAQL      4380
     RLLTDVEEAE LVPARGLPGR SVRTLPQMFA ETAAAAGDAT ALVFGDRRMS YRELDERSNQ      4440
     LARLLIDRGV GPEDIVALGI SRSIESVLAV WSITKTGAAF VPVDPTYPRE RVEHMVTDSG      4500
     CTFGLRLEAD HGRLPDTVRW LTLDDTETAT AIRAMSTDTV TDDDRVAPLR FAHPAYVIYT      4560
     SGSTGKPKGV VVSHRGLDNF AEEQRTRYAT DSTSRALHFS SPSFDASVLE YLLSFAVGAT      4620
     MVIVPPSVYG GEELAELIRT EGVTHGFVTP AALASVDPEG LEVFQNVVAG GEAVPPELVT      4680
     RWAPGRTMYN GYGPTETTIM SNLSDHLQVG ETVTIGAPVR GVSEVILDSR LQPVSVGVAG      4740
     ELYISGEGLA RGYHARAGLT SERFVANPYG EPGDRMYRTG DLARWRSDHT VEYLGRTDFQ      4800
     VKIRGFRIEL GDIDSALAAH PSVAFAVTLG RPGPAGDTVL VSYVLPEAES ALEPPELKEW      4860
     TANLLPAHMV PSSIMILDEI PLTPVGKLDR AALPEPQFLP TSDDFRPPST VLEHTIADVI      4920
     TTVLGIERVG IDDNFFDIGG NSLIATRVAA RLTAELDTDI GVRTLFEAPT IHQLARLIES      4980
     TAFAPAQDGA HVRIPLGPMP RPAHVPVSLA QKRMWFLNQF DTSSAAYNIP LAVRLTGHLD      5040
     VESLRAAVTD VFVRHESLRT VFPSHDGEPT QVVLSPGQWT PNLEIVEVSE DELREHIAGL      5100
     ATAGFDVTAD VPMRSALFAL APDDHVLVIV VHHICADGFS LTPLARDVMT AYAARIAGSA      5160
     PQWNPLSVQY ADYTLWQLQL LGDESDAESL ISQQLRYWTD QLADLPELLQ LPTDRARPVQ      5220
     QSFRGAQVDF TIPADVHRAL AALARKHNST MFMAVHAALS VLLSALSSTE DIAVGTPIAG      5280
     RGDAALDDMV GMFVNTLVLR SAVDPAAGFG ALMDQVRSTD LAAFHHSDLP FERLVDVLAP      5340
     ERSTAHSPLF QALLEFRNNE TPRLELPELT AAAVDFDLEV AKFDLQLSVE EGFDADGVAS      5400
     GIAASFIFAT DLFDAGTVRT FADRFLRILG AVTSDPLAPV GDIVITDAAE RSAMATEWNT      5460
     AGFDAGTDTL ADRFAQSVAR FPDATAVTSE DVALTYAELD ARSNRLARLL ISQGVGPETL      5520
     VAVALPRTCD LIIALLAVIK TGGGYLPVDI TYPADRLAFV FEDAAPNCVI TTTGDVSALP      5580
     DSETPAILLD DPETTADLAQ QSPATITDAD RVTPLDSSSV AYVIYTSGST GRPKGVVVSH      5640
     RNVLTLFANT QPLYGFDEND VWTMFHSYAF DFSVWELWGP LLYGGRLVVV DYYTARSPEM      5700
     FHELLRNEQV TVLNQTPTAF YQLAETDRIV SEIDVNAAAL ALRYVIFGGE ALDLGQLGRW      5760
     YSRHDDSAPT LVNMYGITET TVHVSYLALD REFAESASAS VIGRGIAGLH VHVLDRRLHP      5820
     VPPGTIGEMY VSGDQVTRGY LGRAGLSSSR FVADPLRPGA RMYRTGDLAR WNTDGQLEYL      5880
     GRSDFQVKIR GFRIELGEIE SALLRYRGIA QAVVLTRDDG HGGHRLIGYV VPESGATVEV      5940
     SSALEFVGTQ LTSYMVPATL VVLDALPLTS NGKLDRRALP EPDFGARVSA GRAPATEMET      6000
     VLAGLFAEVL GLESVGVDDS FFALGGDSIM SIQLVARAKA AGVVLTPRDV FEAKTVAALA      6060
     EAASWAGAAD VVVLDELPGG GIGEMPVTPI TAWLLERGGD FRRYTQTALL SLPAAADETL      6120
     LKRTIAAVVD HHDMLRARLL GAEPQWRIEV QAVGVVDVDD VLHRVEVASV VGSGFAEVAT      6180
     RELDAAAGRL DPEAGVMLQM VWFDAGDQGG RLLVVAHHLV VDGVSWRILV PDLATAWAQV      6240
     SAGQEPTLEP VGTSMRRWSH GLVEATRERA GEIELWRRVL EADDPLIGSR PLDAAIDVAG      6300
     TVEKVTVEVP ADVTDALLTR VPEAFHGGVN DGLLTALALA LAQWRRTHGD FTRESLVSLE      6360
     GHGREDQVLP GADLGRTVGW FTAMFPVRLD LSGIDLDDAF AGGKATGSAV KAIKEQLLAI      6420
     PDHGIGYGML RYLDPESADQ LRALAKPQVT FNYLGRLGGA TSTDIHGHAW VPVTDTKLDD      6480
     IPASDIPVAS ALDINAVTGT GADGNRLRAT WAFPTGVLTP SEVRALADLW VQALTALTTH      6540
     VARPDAGGVT PSDLDLVTLD QDAIDRLEAR FPALSDIWSL SPLQSGLLFH AQFSDASVDP      6600
     YLVQLALKLR GNIDPDRIRR AGQALLDRHP NLRAAFVHDS AGASAQIIQQ HVELPWSEFD      6660
     LSALDPDETT REYDRIVARD RSVKFDMANA PLLRLALVRL TEEDYRLILT NHHILLDGWS      6720
     TPLVIRDLLT LYALDADGSL LPRVHSYRDY LSWMKRHDTT DSLDAWRTAL DGVEEPTLLA      6780
     PLERGEAHSA VAEETAFTLS EEQTTRLRDL SRERGLTLNT VVQTAWGIVL GGLVGRSDVV      6840
     FGGTVSGRPP QIAGIESMVG LFINTLPVRV TLDPWESLGE LLERVQSEQA ALLDHHYVGL      6900
     TDIQSAVGGG GAFDTLTVFE SYPVDEAGLT EQTDIAGMFV TGIDGKDSAH YPLAVVASGD      6960
     ARLNFKFEYL PEVFEESAVD EIADRLQRVL DALADRPEIP LAHMQLLTEA ELAEFAPVRG      7020
     RPGFSVRTLP QIFEDAAALD PNRTALTFEG RNVSYRELNE RSNQLARVLI SRGAGPETFV      7080
     ALGIPRSIES VLAVWAVAKT GAAFVPVDPN YPMDRIEHML TDSGATIGLT MAAYEKALPD      7140
     SVPWLQLDSP KFEKACQSKP ALPVADSDRR SPISLDNAAY IVYTSGSTGK PKGVVVTHEG      7200
     LDNFAEDQRQ RFAAAQTSRT LHFSTPSFDG SVFEYLQAFG VGATMVIAPP TVYGGAELAE      7260
     LIRSEHVTHA FVTTAALSTV DPTGLDEFQH VVFGGEACPP ELVTRWAPGR QLSNAYGPTE      7320
     TTVMANISDP MTVGDPITLG GPIRGVGELV LDSRLQPVPV GVPGELYITG AGLARGYHRR      7380
     PELSSQRFVA NPFGEAGERM YRTGDIVRWR ADHTVEYVGR SDFQVKIRGF RIELGEIDNE      7440
     IATFPGVSFA ATLGVPGPSG DTVLVTYLLP NTAGGVDPAE LTAHLSTRLP AHMVPTSVMF      7500
     LDEIPLTPVG KLDRSALPAP EFHVTTTEFQ PPTNDLERKI VDIFADVLGI ERIGIDDNFF      7560
     DLGGNSLVAT RVTARLRDAL DTDIGVRALF EAPDVRSLAA RVADSVSGGA RPALAPVERP      7620
     DRIPLSLAQK RMWFLNQFDT SSPAYNIPLA VRLTGTLDED ALRLAMADVL ERHETLRTVF      7680
     PTVDNEPTQR ILPAADAQPG VDTVSVAAED LPRHIMDLVS RGFDVSTDVP VRAALFRIAP      7740
     DHHVLTIVVH HISADGFSLA PLARDVMVAY TSRLGGDGPQ WDPLHVQYAD YTLWQHAGLG      7800
     SENDPESMIN QQLRFWSETL AGVPDVIQLP TDRPRPIQQT FEGDRVEFAI DADLHQRLTA      7860
     LARANNATMF MAVHAALAVL LSRLGSTDDV VIGTPVAGRG EAALDDMVGM FVNTLVLRNR      7920
     IDPASTFTEL VQRIRETDLA AFQHSDLPFE RLVEELNPTR STSYSPLFQV ALEFQNNENP      7980
     TLELPDLRVE NVDLETKVVK EDLEVILAEQ FDQDGAPAGV AGGLDFAVSL FDRGTARSIA      8040
     DRFVRILAAV TADPDRPIGT LPLLDEAEIE EMVPARGKPD VRPEVWPDLL TAAAALDPDS      8100
     VALSFEDRQV TYRELDEWSN RLARVLCAQG VGPETFVAIG MPRSIEEVVS IWSVAKSGAA      8160
     FVPVDPTYPR DRIDYMLTDC RASVGLTVAG RRDNLPDTVP WLVLDDESFA EQVAAVSSSP      8220
     VTDADRTRPL HLAHPAYLIY TSGSTGKPKG VIVTHRGMAN LTAEEHERFQ VTHESRVSHL      8280
     ASPSFDASIF ELMMAFGASA RVVIVPPTVF GGTELADLFR RNAVTHAFIT PTALSSIEDV      8340
     GLESLRVLAV AGEACPPELV EIWGKHRNMH NGYGPTETTI QASVSAPMRP GGVVNIGAPA      8400
     LGFGSLVLDE RLQPVPVGVP GELYITGPGL ARGYHNRSAL TSERFVACPF GEPGRRMYRT      8460
     GDVVRWRGDH TIEYIGRTDF QVKVRGFRIE LGEIDAVLAR HPAVAFAATI GHTGPSGDTL      8520
     LASYVRAAEG HDLEPAELRT HAADRLPAHM VPSAVVVLDQ IPMTPVGKLD RKALPAPEFG      8580
     TTGAAFRAPT TATERIIVEA FAEVLGVDRV GTADSFFDLG GNSIVATRVI TVLQERLGRQ      8640
     IPLQSMFLDP TPAGLALRVD TENAAGSPVD EALGVVIPLR PTGDKPPLFC IHPGIGLSWG      8700
     YAGLLQHLSQ DRPAFGLQLP IISGGPSFES IEQLAHQYVL EMRKVQAHGP YHLLGWSLGG      8760
     VIAHAMAVEL RREGEAVDTL AVMDSYVTGG TDQGPESLTV PELLHGLGLD LESVSGEELT      8820
     YERAVELLDD AFGQKTGLTP QHLERISAGF TNSSRIMNNF RPQVFDGDLL FFTAAGSAST      8880
     DQHSPEEWRS SVTGGIREVK IECEHNQMIE PEVLAVVGPV LEDYLSAH                   8928
//

If you have problems or comments...

PBIL Back to PBIL home page