(data stored in ACNUC7421 zone)

EMBL: CP000431.PE143

CP000431.PE143       Location/Qualifiers
FT   CDS             171854..172366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00143"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_function: GO:0046872 - metal ion binding;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91979"
FT                   /db_xref="GOA:Q0SKF7"
FT                   /db_xref="InterPro:IPR025182"
FT                   /db_xref="InterPro:IPR038638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF7"
FT                   /protein_id="ABG91979.1"
FT                   /translation="MVNHLTARRLDARPVRCRGCICAACGNQSGGRGVVDECERLVLVQ
FT                   AYSRGDDRGEDTTMADRVLRGSRLGAVSYETDRDHDLAPRRMAKYRCDNGEVFDIPFAD
FT                   DAEIPGTWLCRNGLEGTLVEGTAPEAKKVKPPRTHWDMLLERRSKEELEELLKERLDLL
FT                   KAKRRGA"
     MVNHLTARRL DARPVRCRGC ICAACGNQSG GRGVVDECER LVLVQAYSRG DDRGEDTTMA        60
     DRVLRGSRLG AVSYETDRDH DLAPRRMAKY RCDNGEVFDI PFADDAEIPG TWLCRNGLEG       120
     TLVEGTAPEA KKVKPPRTHW DMLLERRSKE ELEELLKERL DLLKAKRRGA                  170
//

If you have problems or comments...

PBIL Back to PBIL home page