(data stored in ACNUC7421 zone)

EMBL: CP000431.PE144

CP000431.PE144       Location/Qualifiers
FT   CDS             complement(172901..204019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00144"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.13"
FT                   /EC_number="6.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91980"
FT                   /db_xref="GOA:Q0SKF6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91980.1"
FT                   /translation="MSFRGWPVGVVPTAVVGKRTNKVVDAVPSGDVTAVDRIPDGAFPL
FT                   STAQRGMWFAQQLDPEVPVTIAQCVELVGVLDVALLSESLITAGRELGSAFLRLVEVDG
FT                   VPYQLVDPTLDASVRFVDLQREPDPRAAAKEWMRQEYTTPLDVCRDRLVTSAVLCTGPD
FT                   RHYWYSRVHHVALDGMGSMTLIDRTTQLYTAAVQGRTAAPSKAAALTDVARVDDDYRIS
FT                   PRYRADQEYWSERVSTIGETHSLVERSAPARARSRTAGGQIPGTLVDHLEAATDRHDSS
FT                   TAFEVIAAFAAYLSRMTGREEVAVSLPVTARTTALLRRSGGMVSNVVPLHLHVRPDMTN
FT                   ADLVAAVRLEVTAALRHQRYPHIDIRRDAATEHQGFYGPLINVMLFHDEITLGSIVGRL
FT                   ELLSTGPITDLAVNVYHGVAGTSLNLDFEANPDLYSEGTLRAHHTRFTRFLGAFLTSDT
FT                   DEPRRVGDLDILDDDESRTLVPASGRAGFAPVTLPDLLGGAVRSNRDGDALVAPGHGIS
FT                   SADTLSYRALDEASNRLARLLIDLQVGPEVMVALALPRSRESVSSVWAVAKAGAAFVPV
FT                   DPSLPADRIAFMLEDCGAPIGITTAALRDGLPECTHWIVLDDDEFRATAAAYPPDAVTD
FT                   TDRTRALSVDHPAYVIYTSGSTGRPKGVAVTHRGVVNLAADERDRLVVSSGSRVLHFAS
FT                   PSFDASVFELVMAVCAGATLVVAPTTIYGGTELAELMAEQRVTHAFCTPAALASLDHRG
FT                   LDHLRTVVVAGDVCPPELVARWAPGRIMVNAYGPSETTIMSSATGPMVPGQPVTVGSPT
FT                   VGVDLVVLDHRLRPVPAGVRGELYVLGSSLARGYVRRAGLTAERFVASPFGTGGRMYRT
FT                   GDVVRWVTAPDGPPVLEFLGRSDFQVKIRGFRIELGEIDAALTAHPVVEFAYTVGYDDG
FT                   SGSSRLVSYVLPVPATDVETRVLSEFVGERLPGYMVPSSIMMLDSLPLTPAGKLDRNAL
FT                   PAPVFAARSADIVRPRTVTEEILLGIFRDVLGLPELSVDTSFFELGGNSLMATQVVSRV
FT                   NTALGVRIGVRDLFQSPSVSQLAVPAANTGPQADSRPVLEARERPDHVPLSVAQQRMWF
FT                   LNQFDTASPAYNLPISLRLTGALDREALRAALGDVQERHEALRTVFPDTPDGPHQLVVP
FT                   VVSVLAETDPIDVDAKSLTAAVTALGGAGFDLTTDTPLRAGLFREAPDRHVLVLVVHHV
FT                   AADGWSMTPLAADVMVAYAARVAGHAPTWAPLPVQYADYTLWQRELLGSEDDPDSVSAR
FT                   QIAHWQSALAGVPQLLELPADRPRPAEMSHRGGRVEFTITADVHGRLVDLAQSTGTTLF
FT                   MVTHAALVVLFHRLGAGTDIVIGTPVAGRGEEALDDLVGMFVNTLVLRATAEPGDTFEE
FT                   VLDRVRDADLAAFSHADVPFERLVEVLSPDRSAARHPLFQVMLSFQNTAPTSVELPGLE
FT                   VAAAEIDVHVAKFDLQLTVTERFVGAGMPGGLAAGFDYATDLFDESTVASMAERFANLL
FT                   RSVAASSATVVGDLSLLHAAERDRLLGTWNDTAHRVPAMCLPELFDAQVARTPDAVAVV
FT                   FGDVTLSYSQLDCRANSVARYLIDRGVGPESRVGLAMRRSPDLLVGMYAIVKAGGAYVP
FT                   VDPDHPTDRIGYVLDSAQPVCVLTTSADRGALPAGQSFVEIDRIALDSYSGGPVTDSDR
FT                   LAPLRPDNPAYVIYTSGSTGRPKGVSVPHRGIVNQLLWMQSEYALTERDVLLQKTATTF
FT                   DVSLWGYFWPLHTGATMVLATPDGHRDPEYLARVIDEHGVTVTDFVPSMLDAFVASVPI
FT                   TSCSTLRHVFVIGEALPPETVTRFRALSDAGLHNLYGPTEAAVSVTYWDTATTVAGTVP
FT                   IGVPEWNTQVYVLDSRLHPVPPGVAGELYLAGEQLARGYLGRVDLTSDRFVANPFTPGL
FT                   RMYRTGDLVRWTSAGALEYIGRTDFQVKFRGQRIELGEIEFVLRAQPSVTSAAVLVHSD
FT                   PGTGDRLVAYVVPEPGHDLDTTRLRECAAASLPAYMIPAALMVVDEFPLNTSGKLDRQA
FT                   LPAPEFGGSGTEYVAPRTSVEANLAEIFAEVLGLDRIGLRDNFFDVGGNSLVATRVTSR
FT                   IRAELGAPLALRDLFDAPTVGALAERIEGTVQTTPRAPLVAATRAGRIPLSPAQRRMWF
FT                   VNQFDTASAAYNMPFALRLSGILDCDGLRSAIRDVLERHESLRTLYPDSTDGPHQVIVG
FT                   ADEVPLDLDVQPITEAELPTRLVELATEGFDVTSAVPLRTALLRLSVDEYVLAVVVHHI
FT                   SADGSSMAPLARDILLAYTARTAGRAPSWPPLDVQYADYSYWQAEFLGDETDGRSQATE
FT                   QIEFWSAALDGIPDLLELPADRPRPAMPTNSGATVPFSVDAATAKAVADLAARSAATPF
FT                   MVWHAALSVLLSRLSNAVDVTVGTPVAGRAEPSLQDLVGMFVNTLTLRARVSGDLSFAD
FT                   LLAQVREFDLAAFAHADLPFERLVEVLEPARSTARHPLFQVGLSYENFEPGVLELPGLT
FT                   VSAVEMNPEIAKFDLNVTLTEIRDERGTVSGLTGAFTYAVDLFDRDTVESFADRFARIV
FT                   TAALADPGTAVGDLPVLDQRELVRVLREWNATDVEVSGRPYLARYDEQAARTPDAVAVV
FT                   YRDVSVTYREFNSRVNRLARKLIAEGAGTETTVAVAARRSIEFLIALHAVLRSGAAYVP
FT                   LDVDLPAERVAHVIEAAHPVLVLTAVRGEFESDSGVRVLPIDGLELDRFDDAPVTNRDR
FT                   LRPLAADNLAYVIFTSGSTGRPKGVAVSHAGLGSHFEFLMSLCALDETDRVVVKTPQSF
FT                   DASLWELLWPLAVGARVVIAEPDGHKDPDYLAELIDTEQITAIHFVPSMLAVFTDVIAP
FT                   SRFSSLRTVFVGGEALSVNVARRFAAVSDAAVLNAYGPAEVAAASTTSWVDTSNSAIVT
FT                   VGTPVWNTRAYVLDQRLHPSPAGVTGELYLAGTQVSRGYAGRPDLTAERFVANPFDAPG
FT                   TRMYRTGDRLRWTGRGELEYLGRNDFQVKLRGLRIELGEIEAVLESADSVAQAVVTVYS
FT                   GAASEQLVAYLVARAGTRVDIEALTAYAASRLPEYMVPDGFVTLDAFPLNASGKLDRVA
FT                   LPAPAVGDVAVDRVEPRTPMEESLAALFREALGVDDLGVNDSFFALGGDSIVSIQLVSR
FT                   AKAAGIVFTPRDVFERKSIAALAEVVTVASADRLALAELAGGGVGNVELTPVVRSLLDR
FT                   SGSVGRYSQSVLLTLPTGIERSDIVATVQAVLDRHDALRSRLVRDGADVRHSVLPTGAV
FT                   DADRLVTTVSVNPDLGDAAFDALIDRELSAAADRFDFETPVLTQFVWLDRGATRPGRLL
FT                   VVAHHLVVDGVSWRIIVPDLVAAGGAVAAGHAPNLPEVGTSLRRWSHGLSEAARQPSTV
FT                   AQFDYWRSVVDAADPLLGGRALDPVRDRTSTTQELHVELSTEITATLLARVPEAFGCSV
FT                   GDSLLAGFAVALTEWRRARGVPAASAYITLEGHGREESVVPGADLSRTVGWFTSVYPVR
FT                   LALEGVDTQDALVGGASAGAAIKAVKEQLLAVPDRGVGYGLLRYLNPATATVLAGFDPP
FT                   QVVFNYLGKTGMGDLSPEMREIGWVPDLESSRVFSGETDQDMSASAAIEINAGVTDTDA
FT                   GPRLGASVRFAGELLAADDVRELVDLWQQALVSQIEHVVAGSGGGLTPSDIGTVALTQS
FT                   QIDLWERAYPTLEDVWALSPLQAGFHFHSLLAAEHSVDVYHSQLRMTLLGDVSADRMRA
FT                   AAAALLDRYSNLRVVFVQDGDVTAQIPLRGVEVPLTVVDLSGRESDSGERELESLVAEN
FT                   RTAPFDLSEAPLLRLLLVRTGADRHELAMTNHHILLDGWSIPLIVQDLLVLYATAGDQS
FT                   ALPAVRPYREYLDWLTRRDPSASRAAWAHALEGFDEPTLLAPAHTGGSATADPEEVPVH
FT                   FSAADTAELLAFARQHGVTPNTVIQTAWALLLRRLTGRDDVVFGATVSGRPPHIPGIES
FT                   MVGLFINTVPVRVRIDADESVAELLVRVQGQQADLLDHHYLGLTEIQAEAGVGALFDTL
FT                   TVFESYPMDQAALQAQTDIAGMRVDSVQVHSVTHYPLSLMAQVDDTLRLGVAYLPDTFE
FT                   RDEARLIAARLDSVIRALIAEPSAAVAQVTGFIPGEYARVMHDWNATGHHVPESTLLTL
FT                   FEAQAARTPDAVAVDFDGDVLTYAALDARANQLARHLIALGVAPETRVAVVMRRSLELV
FT                   VGIYAVLKAGGAYVPVDPDHPAERTSYVLASAQPVCVLTTSADRPDLPNRIPVSALDTL
FT                   DLSGVSAVPLTDAERIEPLRPAHPAYVIYTSGSTGKPKGVAVPHAAIVNQLLWMQSEYA
FT                   LTDRDVWLQKTATTFDVSLWGYFWPLQVGATMVLATPDGHREPAYLTRVIDERAVTVTD
FT                   FVPSMLDVFVAAAPEGTCRSLRLVFVIGEALPPATVLRFRELSAAGLHNLYGPTEAAVS
FT                   VTYWKTGDADTTNVPIGVPEWNTQAYVLDSRLHPVPVGVPGELYLGGAQLARGYLGRVD
FT                   LTSDRFVANPFGRTGERMYRTGDLVRWTSSGALVYIGRTDFQVKFRGQRIELGEIETVL
FT                   RSHPAVTGAVVSVYSDTTVGDHLVAYVVGTPGELDVAELRRQASESLPSYMVPSAITVL
FT                   DEFPLNTSGKLDRKELPAPEFHGSSTEYIAPRNEAERTVAAVFADVLGSSRVGAHDNFF
FT                   DLGGNSLSVTRVAARLGELSGTGLSVRDVFTAPTVAELARRLAEPTAAGGARPVLSGMQ
FT                   RPARIPLSPAQQRMWFINQFDPSSPAYNLPFAVRMSGALDVAALSQALDDVVGRHESLR
FT                   TVFPDTDDGPAQVVVSAADLSMPLEVVDVPEGELDSRMIAFSSHGFDVSEDLPVRATLF
FT                   RTGPGEHVLAITLHHIAADGWSFGPLGADVMVAYAARAESRSPEWIPLAVQYADYSVWH
FT                   RAVLGSEDEPESLARRQLEYWTRTLDGLPDELKLPFDRPRRTEQSYVGGSVGFTITPEI
FT                   HSGIERLAREHGATVFMVAHAAFALLLARLSASDDIAVGAPIAGRGERALDNLVGMFVN
FT                   TLVLRTRIESTETFAELLTRVRDGDIGAFGHADLPFERLVDVLDPVRTSAHHPVIQTAL
FT                   SMQPTAIDDIELPGLRVRVEDIDARVAKFDLQLTLGEDIDPAGVPSGIRAEFTYAADLF
FT                   DDVTVRRYAGQLVRILETVIADPTTVVGDVNLLDDAERARLAPVRGPASRPSRLLPEVL
FT                   AESAADPSATALVFGDRSMTYGELDRRSNLWARELIEAGAGPETFVAVALARSIESVLA
FT                   VWAVAKTGAAFVPVDPNYPAERIAHMLGDSGSALGLTTIEFRAGLPDSTQWLVMDDPDH
FT                   TALVTSHSSAAVTAADRLGRMHADQLAYLIYTSGSTGLPKGVAVTHSGLANLLTELADE
FT                   YELTADARTLHFASPSFDASVFEYLMAFCRGATMVVVPHSVYGGTELAELLGAQGVTHA
FT                   FFTPAALASVDHTGLDELAVIVVGGEAWGADLAERWVPGRALFNGYGPTESSMMVTQSG
FT                   PLMLGERMTIGAPVRGVEAFVLDARLHPVSPGVPGELYISGPALARGYHQRLGLTAERF
FT                   VANPHGAPGRRMYRTGDLVRWVESRTGTYVIEYVGRSDFQVKIRGFRVELGEIDSVFRA
FT                   HSAVGFAATIAHDTESGVTALVTYVCAASGNDVDVDDLTAFVGGVLPAHMVPGSIMVLD
FT                   SIPLTPAGKLDRRALPEPVFVSHTRFTAPDTADEIAVAAAFADVLGESRIGVDDNFFAL
FT                   GGNSLSATQVVSRVGSAFGTRVSVRTLFDNPTVRQLVSAVATSGPDASSGRPALTRREH
FT                   PGRIPLSLAQQRIWFLNQYDPSSSAYNIPLALRMSGRIDVPALRAALGDVLERHESLRT
FT                   VYPGSADGAHQEILPAAAAEFDLTPIRTAPDQLMLRIAEYAVAGFDVTREIPFRIHLFR
FT                   ENRSEHVLLLVAHHIAADGWSFGPLAADVMAAYASRVEGLAPSWEPLPVQYADYSVWQR
FT                   ELLGAEDDPDSLSATQIERWRAALDGAPEALDLPTDHPRPAVASHRGERVDFEIDADTH
FT                   RGLVERAQKGGTTLFMVVHAAFATLLHRLSGSTDIVIGTPVAGRGDEGLDPLVGMFVNT
FT                   LALRTRIDPGESIDALLEQVRDVDLTAFQDTEVPFDRLVEILRPTRSSDRHPLFQVMFA
FT                   FQNLRPVTMELPQLVVEAVDFDPHIAKFDLDLALAEIVDDAGHHHGISGAFTFASELFE
FT                   RATVAGFADRFLRILEAVASADDIAVGDIAILGAAEQGSLAPVWGGPLLANATLPELLV
FT                   ATAERYPDSTAVVFDGVSIDYRELDRRSTQLARALIGMGVGPETYVALALPRSVESVLC
FT                   VWAAAKTGAAYVPIDPAHPADRIAHILRDSGVVVGVTCAEFAEHLPGVTDWLVLDDPAV
FT                   LRELSSASTAPVGDADRTSALHVDHPAYLIYTSGSTGLPKGVVVSHRGLANLAGSYTTA
FT                   VRATEESRVAHLASPTFDLSVLELLLAHTSGAALVVCPPGVYGGVELHEVLQSERVTHM
FT                   TITNAALASVEPEGLDDLRSIVVGGDACPPETVARWADRLELVNGYGPTEVTVGATFSS
FT                   VLGQGRDITIGGPLPGVAAVVLDSRLRPVPVGVVGELYLLGPALARGYHERAALTAHRF
FT                   VASPFEAAGARMYRTGDIVRWRAVHSGVTGSMTDGTFPGHAIEYLGRSDHQVKVRGLRI
FT                   ELGEIDAALNAHPDVEFAATLGYESPAETRLASHVLVGAGADRDPAALLAFLRQALPGY
FT                   MVPSALVFLDTIPLTPNGKLDRDALPAPDFGAAAKEIVYREPRNPLEQSIADAFAEVLG
FT                   GTDIGLDTDFFDAGGNSLSATRVTARVGALLDIRVTVRDLFEAPTVLALAESLAPRMSE
FT                   AGDGASAGPALAPQPRPDRIPLSLAQQRMWFLNQFETSSPAYNLPAAVRLTGPLDTAAL
FT                   AAAIDDLITRHESLRTVFPDSRGGPHQVILEPGQFTPDTAPVRVSESGLRADLEQFLLT
FT                   GFDVSQAVPLRVKVYSLGDTEHVLAFVVHHIAADGVSMEPLIRDVMIAYSSRAAGHAPS
FT                   WAPLPVQYADYALWQREVLGVESDPGSLAAAQLEYWTRTLAGVPDQLYLPGDRGRPAVP
FT                   SHRGAATRFTLDADTHRALAELARAHGASIFMVAHAALSVLLGRLSTSSDITVGTAIAG
FT                   RGRVELDDIIGMFVNTLVLRTTLDPGASFVSLLEQARDVDLEAFAHADLPFERLVEVLS
FT                   PVRSTSHHPLFQVALGVQAVSADRLELDGLSLEPLTLDASTAKFDLHFTLTERLDDASE
FT                   AAGIDAELVYATDIFDESTAAEYAIRLRRIFEAVVADPQRPIGDIPVLGDEEYAALTPV
FT                   RGADARPVQMLPEILADAVAAAPDGPAVVFEGESLTYRDLDERSNQLARLLVDRGVGPE
FT                   TRVALALPRSLESVVAVWAVAKTGAAFVPVDPGYPADRVLHMVQDSGAMVGITVSAKQD
FT                   VLPDSIRWMLLDDPALAVRCTHESRLPLTNRDRMRPILSDQVAYVIYTSGSTGRPKGVA
FT                   VTHRGLMNLVTDERELLGVTSGSRTLHFASPSFDASVFEMLMALGAGATMVIAPPTIYG
FT                   GSELAELLAAEHVTHAFSTPAALASVDHHGLDDLAVVVVAGDVCPPELVARWAPGRRMV
FT                   NAYGPSEATIMSSITEPLRAGEPVTIGGPSRGVRALVLDGRLRPVPVGVPGELYVGGPS
FT                   LARGYLGRPGLTAERFVADPYGEPGDLMYRTGDLVRWRENRVLDFVGRTDHQVKIRGFR
FT                   IELGEIDAALTAHPQIEYATTIGYEHPNGETSLVAYVLPFTGEDVDRVEVANFVGRTLP
FT                   AYMVPASVTLLDALPLTPAGKLDRAALPEPIFVAAATTFEAPRNPMEVIVAGIFADILA
FT                   LPEIGIHDSFFDLGGNSLLATQVVSRINAALDVHVGVREVFESPTVAALAARITETTTH
FT                   GVRRPALTAKPRPEHIPLSLAQQRMWFINQFDTASPAYNLPVALRLSGEVDLRAMQIAI
FT                   ADLVGRHEALRTVYPDSVDGPHQVIVPAGDAVPDLTPVAAHPDDVLDRVLALVTTGFDV
FT                   TADVPLRARMYRVGADDYVLVMVAHHISGDGWSLAPLARDVMLAYTARAEGHVPRWTPL
FT                   PVQYADYSLWQRELLGDETDPESVAAAQIAYWTRTLEGLPDRPSLPTDRPRPAVASHLG
FT                   AHVPFTIDAGTHRALLALARGRNTSLFMVMHTALAVLLARLSNESDIAVGAPIAGRGEE
FT                   SLDELVGMFVNTLVLRTRVALASSFADSLADVRSADLNAFAHSDIPFERLVDVLNPARS
FT                   RAHHPLFQVAFSFQNLATTTLELPGLHVEGLDVPNTISNFDLHLTLSEKHDADGSPDVI
FT                   EAQFTYATDLFDESTVRAFAERFTRVLASVVEDPDVAVGAIDLLDGPERQSIVADFNDT
FT                   GVDLPPTTLAELFSAQAARTPEKAAVFFEGTELTYAEFDRRVDVLAHRLIDRGVGPESV
FT                   VGLAMNRSIELLVGMYAVLRAGGAYLPIDLTHPADRLAYVLATARPVCILTTSSDGFAA
FT                   ESVPVIEIDTLDHTGSPREPVTDARRLAPLRPENTAYLIFTSGSTGRPKGVAVTHAAIA
FT                   NQLRWKQHEYSLDTTDAVVQKTPVTFDLSVWELFWPLTTGARLVIARPDGHRDPAYLAD
FT                   LMRQQRVTTAHFVPSLLEAFLATPDAGEQPALRRVLCIGEALPVDTAARFRRRFGTVAL
FT                   HNLYGPTEAAVSVTAWTHTADDVDTVPIGGPEWNTQVFVLDARLNPVPVGVAGELYLAG
FT                   EQLARGYVARADLTAERFVANPFGASGSRLYRTGDVVRWHVRDSRGVLEYLERSDFQVK
FT                   VRGFRIELGEIESALVSSAGVGQAVVVAHQHPHTGTTLIGYVVPEDGATVDFAAVLAEV
FT                   GAAVPSYMVPAALVVLAQLPLTSNGKLDRRALPAPDFASATDEYRAPATPTEEAVAAVF
FT                   ADVLGVDQVGTAANFFDLGGNSLVATRVVARLSERLGCRVEIRTLFEAPTVAALAALLD
FT                   SIDATAPARPALTPAVRPERIPLSSAQHRMWFLNRFDPNSAVHNIPAAVRLSGALDVDA
FT                   LQHAVADVVRRHESLRTVYPDSADGPHQVILPIDRVGGEMSVVATDEAALPALIAGLVT
FT                   TGFDVTTEVPVRVRIFRMSATEHVLALVVHHISGDGWSMAPMVRDVMTAYAARSADTTP
FT                   DWAPLPVQYADYALWQRALLGDETDPESVSARQLAFWTHTLAGAPDQLDLPTDRPRPAV
FT                   ASYRGGTVDFTVPADLHGTLLGAARDANASLFMLVHAALAVLLSRLSGTGDIAIGTPVA
FT                   GRGERELDDLIGMFVNTLVLRQQVDGGRTFAELVADVRETDLAAFSHADVPFERLVEVV
FT                   NPSRSTGRHPLFQVMLTFQNLDQATLRLGDLSVSGVDFDVDIAKFDLQLTLMEQFDSAG
FT                   SPDGIAARLTYASDLFDEPSMHVFGQRFQQVLRAATDSPDTAVGDIDVLGSGERKQIAG
FT                   TNATSHEVPAGTLASLFDTRVAADPVRVAVIFDRDELTYADFDARVNRLARRLIEQGVG
FT                   PESVVAVAMRRSIDLLVAIYAVVKAGGAYLPVDPDHPAERTAHVLDTAQPACVLVSGAG
FT                   LAGGGSVPVIDVASEDVSGFDSSPVTDADRLWPLSPANTAYVIFTSGSTGRPKGVAVTH
FT                   GAIVNRLLWMQHEYTLTSADVVLQKTPVTFDVSVWELFWPLQVGASLVIAAPDGHRDPR
FT                   YLTGLIQERHVTTTHFVPSMLSVFTAEPAVAVCDSLRLVFCSGEALTPEQVSRFRAVCG
FT                   ADLHNLYGPTEAAVDVTYWETGAADTVTVPIGRPVWNTQVHVLDSRLHPVPNGVAGELY
FT                   LAGDQLARGYLNRPDLSADRFVANPHVAGGRMYRTGDLVRRRADGVLEYVGRTDFQVKL
FT                   RGQRIELGEIEAALEAHPDVSQAVVVVHRDDRGEEALVAYLVGPRAADWSDVRAHLSAR
FT                   VPSYMIPAQVVHLDTLPLSANGKLDRTALPAPAARSAADEYQAPRTAAERAVATVFADV
FT                   LGIDRVGVTDSFFDLGGNSLIATRVASALGSELGIDFPLQWMFSDPTPQSLGQRIQKWT
FT                   NDGVDGAGASLDVLLPIRTRGTAEPLFCVHPFIGLAWSYAGLGRELTQDRPIYGLQSPA
FT                   LTEDEPHLETITDFAARYVREIRSIQPHGPYHLVGWSLGGVIAHEMGVQLQDAGEEVRL
FT                   LGLLDSYVGIDRSVENSATTADLLGGVGLDLPDDSVLDELAPDGQFDAERAAALLRVVG
FT                   GPLAALTATELERIYGNALRAPALIDAHRPRVFDGELVFFTAALDDGFHVDPVTCWGQF
FT                   VRGSIDEHPVDATHWTMTTPDALAAIAPHLERSHRRPRHAAPDTGRDSDPDDSANRPHS
FT                   VR"
     MSFRGWPVGV VPTAVVGKRT NKVVDAVPSG DVTAVDRIPD GAFPLSTAQR GMWFAQQLDP        60
     EVPVTIAQCV ELVGVLDVAL LSESLITAGR ELGSAFLRLV EVDGVPYQLV DPTLDASVRF       120
     VDLQREPDPR AAAKEWMRQE YTTPLDVCRD RLVTSAVLCT GPDRHYWYSR VHHVALDGMG       180
     SMTLIDRTTQ LYTAAVQGRT AAPSKAAALT DVARVDDDYR ISPRYRADQE YWSERVSTIG       240
     ETHSLVERSA PARARSRTAG GQIPGTLVDH LEAATDRHDS STAFEVIAAF AAYLSRMTGR       300
     EEVAVSLPVT ARTTALLRRS GGMVSNVVPL HLHVRPDMTN ADLVAAVRLE VTAALRHQRY       360
     PHIDIRRDAA TEHQGFYGPL INVMLFHDEI TLGSIVGRLE LLSTGPITDL AVNVYHGVAG       420
     TSLNLDFEAN PDLYSEGTLR AHHTRFTRFL GAFLTSDTDE PRRVGDLDIL DDDESRTLVP       480
     ASGRAGFAPV TLPDLLGGAV RSNRDGDALV APGHGISSAD TLSYRALDEA SNRLARLLID       540
     LQVGPEVMVA LALPRSRESV SSVWAVAKAG AAFVPVDPSL PADRIAFMLE DCGAPIGITT       600
     AALRDGLPEC THWIVLDDDE FRATAAAYPP DAVTDTDRTR ALSVDHPAYV IYTSGSTGRP       660
     KGVAVTHRGV VNLAADERDR LVVSSGSRVL HFASPSFDAS VFELVMAVCA GATLVVAPTT       720
     IYGGTELAEL MAEQRVTHAF CTPAALASLD HRGLDHLRTV VVAGDVCPPE LVARWAPGRI       780
     MVNAYGPSET TIMSSATGPM VPGQPVTVGS PTVGVDLVVL DHRLRPVPAG VRGELYVLGS       840
     SLARGYVRRA GLTAERFVAS PFGTGGRMYR TGDVVRWVTA PDGPPVLEFL GRSDFQVKIR       900
     GFRIELGEID AALTAHPVVE FAYTVGYDDG SGSSRLVSYV LPVPATDVET RVLSEFVGER       960
     LPGYMVPSSI MMLDSLPLTP AGKLDRNALP APVFAARSAD IVRPRTVTEE ILLGIFRDVL      1020
     GLPELSVDTS FFELGGNSLM ATQVVSRVNT ALGVRIGVRD LFQSPSVSQL AVPAANTGPQ      1080
     ADSRPVLEAR ERPDHVPLSV AQQRMWFLNQ FDTASPAYNL PISLRLTGAL DREALRAALG      1140
     DVQERHEALR TVFPDTPDGP HQLVVPVVSV LAETDPIDVD AKSLTAAVTA LGGAGFDLTT      1200
     DTPLRAGLFR EAPDRHVLVL VVHHVAADGW SMTPLAADVM VAYAARVAGH APTWAPLPVQ      1260
     YADYTLWQRE LLGSEDDPDS VSARQIAHWQ SALAGVPQLL ELPADRPRPA EMSHRGGRVE      1320
     FTITADVHGR LVDLAQSTGT TLFMVTHAAL VVLFHRLGAG TDIVIGTPVA GRGEEALDDL      1380
     VGMFVNTLVL RATAEPGDTF EEVLDRVRDA DLAAFSHADV PFERLVEVLS PDRSAARHPL      1440
     FQVMLSFQNT APTSVELPGL EVAAAEIDVH VAKFDLQLTV TERFVGAGMP GGLAAGFDYA      1500
     TDLFDESTVA SMAERFANLL RSVAASSATV VGDLSLLHAA ERDRLLGTWN DTAHRVPAMC      1560
     LPELFDAQVA RTPDAVAVVF GDVTLSYSQL DCRANSVARY LIDRGVGPES RVGLAMRRSP      1620
     DLLVGMYAIV KAGGAYVPVD PDHPTDRIGY VLDSAQPVCV LTTSADRGAL PAGQSFVEID      1680
     RIALDSYSGG PVTDSDRLAP LRPDNPAYVI YTSGSTGRPK GVSVPHRGIV NQLLWMQSEY      1740
     ALTERDVLLQ KTATTFDVSL WGYFWPLHTG ATMVLATPDG HRDPEYLARV IDEHGVTVTD      1800
     FVPSMLDAFV ASVPITSCST LRHVFVIGEA LPPETVTRFR ALSDAGLHNL YGPTEAAVSV      1860
     TYWDTATTVA GTVPIGVPEW NTQVYVLDSR LHPVPPGVAG ELYLAGEQLA RGYLGRVDLT      1920
     SDRFVANPFT PGLRMYRTGD LVRWTSAGAL EYIGRTDFQV KFRGQRIELG EIEFVLRAQP      1980
     SVTSAAVLVH SDPGTGDRLV AYVVPEPGHD LDTTRLRECA AASLPAYMIP AALMVVDEFP      2040
     LNTSGKLDRQ ALPAPEFGGS GTEYVAPRTS VEANLAEIFA EVLGLDRIGL RDNFFDVGGN      2100
     SLVATRVTSR IRAELGAPLA LRDLFDAPTV GALAERIEGT VQTTPRAPLV AATRAGRIPL      2160
     SPAQRRMWFV NQFDTASAAY NMPFALRLSG ILDCDGLRSA IRDVLERHES LRTLYPDSTD      2220
     GPHQVIVGAD EVPLDLDVQP ITEAELPTRL VELATEGFDV TSAVPLRTAL LRLSVDEYVL      2280
     AVVVHHISAD GSSMAPLARD ILLAYTARTA GRAPSWPPLD VQYADYSYWQ AEFLGDETDG      2340
     RSQATEQIEF WSAALDGIPD LLELPADRPR PAMPTNSGAT VPFSVDAATA KAVADLAARS      2400
     AATPFMVWHA ALSVLLSRLS NAVDVTVGTP VAGRAEPSLQ DLVGMFVNTL TLRARVSGDL      2460
     SFADLLAQVR EFDLAAFAHA DLPFERLVEV LEPARSTARH PLFQVGLSYE NFEPGVLELP      2520
     GLTVSAVEMN PEIAKFDLNV TLTEIRDERG TVSGLTGAFT YAVDLFDRDT VESFADRFAR      2580
     IVTAALADPG TAVGDLPVLD QRELVRVLRE WNATDVEVSG RPYLARYDEQ AARTPDAVAV      2640
     VYRDVSVTYR EFNSRVNRLA RKLIAEGAGT ETTVAVAARR SIEFLIALHA VLRSGAAYVP      2700
     LDVDLPAERV AHVIEAAHPV LVLTAVRGEF ESDSGVRVLP IDGLELDRFD DAPVTNRDRL      2760
     RPLAADNLAY VIFTSGSTGR PKGVAVSHAG LGSHFEFLMS LCALDETDRV VVKTPQSFDA      2820
     SLWELLWPLA VGARVVIAEP DGHKDPDYLA ELIDTEQITA IHFVPSMLAV FTDVIAPSRF      2880
     SSLRTVFVGG EALSVNVARR FAAVSDAAVL NAYGPAEVAA ASTTSWVDTS NSAIVTVGTP      2940
     VWNTRAYVLD QRLHPSPAGV TGELYLAGTQ VSRGYAGRPD LTAERFVANP FDAPGTRMYR      3000
     TGDRLRWTGR GELEYLGRND FQVKLRGLRI ELGEIEAVLE SADSVAQAVV TVYSGAASEQ      3060
     LVAYLVARAG TRVDIEALTA YAASRLPEYM VPDGFVTLDA FPLNASGKLD RVALPAPAVG      3120
     DVAVDRVEPR TPMEESLAAL FREALGVDDL GVNDSFFALG GDSIVSIQLV SRAKAAGIVF      3180
     TPRDVFERKS IAALAEVVTV ASADRLALAE LAGGGVGNVE LTPVVRSLLD RSGSVGRYSQ      3240
     SVLLTLPTGI ERSDIVATVQ AVLDRHDALR SRLVRDGADV RHSVLPTGAV DADRLVTTVS      3300
     VNPDLGDAAF DALIDRELSA AADRFDFETP VLTQFVWLDR GATRPGRLLV VAHHLVVDGV      3360
     SWRIIVPDLV AAGGAVAAGH APNLPEVGTS LRRWSHGLSE AARQPSTVAQ FDYWRSVVDA      3420
     ADPLLGGRAL DPVRDRTSTT QELHVELSTE ITATLLARVP EAFGCSVGDS LLAGFAVALT      3480
     EWRRARGVPA ASAYITLEGH GREESVVPGA DLSRTVGWFT SVYPVRLALE GVDTQDALVG      3540
     GASAGAAIKA VKEQLLAVPD RGVGYGLLRY LNPATATVLA GFDPPQVVFN YLGKTGMGDL      3600
     SPEMREIGWV PDLESSRVFS GETDQDMSAS AAIEINAGVT DTDAGPRLGA SVRFAGELLA      3660
     ADDVRELVDL WQQALVSQIE HVVAGSGGGL TPSDIGTVAL TQSQIDLWER AYPTLEDVWA      3720
     LSPLQAGFHF HSLLAAEHSV DVYHSQLRMT LLGDVSADRM RAAAAALLDR YSNLRVVFVQ      3780
     DGDVTAQIPL RGVEVPLTVV DLSGRESDSG ERELESLVAE NRTAPFDLSE APLLRLLLVR      3840
     TGADRHELAM TNHHILLDGW SIPLIVQDLL VLYATAGDQS ALPAVRPYRE YLDWLTRRDP      3900
     SASRAAWAHA LEGFDEPTLL APAHTGGSAT ADPEEVPVHF SAADTAELLA FARQHGVTPN      3960
     TVIQTAWALL LRRLTGRDDV VFGATVSGRP PHIPGIESMV GLFINTVPVR VRIDADESVA      4020
     ELLVRVQGQQ ADLLDHHYLG LTEIQAEAGV GALFDTLTVF ESYPMDQAAL QAQTDIAGMR      4080
     VDSVQVHSVT HYPLSLMAQV DDTLRLGVAY LPDTFERDEA RLIAARLDSV IRALIAEPSA      4140
     AVAQVTGFIP GEYARVMHDW NATGHHVPES TLLTLFEAQA ARTPDAVAVD FDGDVLTYAA      4200
     LDARANQLAR HLIALGVAPE TRVAVVMRRS LELVVGIYAV LKAGGAYVPV DPDHPAERTS      4260
     YVLASAQPVC VLTTSADRPD LPNRIPVSAL DTLDLSGVSA VPLTDAERIE PLRPAHPAYV      4320
     IYTSGSTGKP KGVAVPHAAI VNQLLWMQSE YALTDRDVWL QKTATTFDVS LWGYFWPLQV      4380
     GATMVLATPD GHREPAYLTR VIDERAVTVT DFVPSMLDVF VAAAPEGTCR SLRLVFVIGE      4440
     ALPPATVLRF RELSAAGLHN LYGPTEAAVS VTYWKTGDAD TTNVPIGVPE WNTQAYVLDS      4500
     RLHPVPVGVP GELYLGGAQL ARGYLGRVDL TSDRFVANPF GRTGERMYRT GDLVRWTSSG      4560
     ALVYIGRTDF QVKFRGQRIE LGEIETVLRS HPAVTGAVVS VYSDTTVGDH LVAYVVGTPG      4620
     ELDVAELRRQ ASESLPSYMV PSAITVLDEF PLNTSGKLDR KELPAPEFHG SSTEYIAPRN      4680
     EAERTVAAVF ADVLGSSRVG AHDNFFDLGG NSLSVTRVAA RLGELSGTGL SVRDVFTAPT      4740
     VAELARRLAE PTAAGGARPV LSGMQRPARI PLSPAQQRMW FINQFDPSSP AYNLPFAVRM      4800
     SGALDVAALS QALDDVVGRH ESLRTVFPDT DDGPAQVVVS AADLSMPLEV VDVPEGELDS      4860
     RMIAFSSHGF DVSEDLPVRA TLFRTGPGEH VLAITLHHIA ADGWSFGPLG ADVMVAYAAR      4920
     AESRSPEWIP LAVQYADYSV WHRAVLGSED EPESLARRQL EYWTRTLDGL PDELKLPFDR      4980
     PRRTEQSYVG GSVGFTITPE IHSGIERLAR EHGATVFMVA HAAFALLLAR LSASDDIAVG      5040
     APIAGRGERA LDNLVGMFVN TLVLRTRIES TETFAELLTR VRDGDIGAFG HADLPFERLV      5100
     DVLDPVRTSA HHPVIQTALS MQPTAIDDIE LPGLRVRVED IDARVAKFDL QLTLGEDIDP      5160
     AGVPSGIRAE FTYAADLFDD VTVRRYAGQL VRILETVIAD PTTVVGDVNL LDDAERARLA      5220
     PVRGPASRPS RLLPEVLAES AADPSATALV FGDRSMTYGE LDRRSNLWAR ELIEAGAGPE      5280
     TFVAVALARS IESVLAVWAV AKTGAAFVPV DPNYPAERIA HMLGDSGSAL GLTTIEFRAG      5340
     LPDSTQWLVM DDPDHTALVT SHSSAAVTAA DRLGRMHADQ LAYLIYTSGS TGLPKGVAVT      5400
     HSGLANLLTE LADEYELTAD ARTLHFASPS FDASVFEYLM AFCRGATMVV VPHSVYGGTE      5460
     LAELLGAQGV THAFFTPAAL ASVDHTGLDE LAVIVVGGEA WGADLAERWV PGRALFNGYG      5520
     PTESSMMVTQ SGPLMLGERM TIGAPVRGVE AFVLDARLHP VSPGVPGELY ISGPALARGY      5580
     HQRLGLTAER FVANPHGAPG RRMYRTGDLV RWVESRTGTY VIEYVGRSDF QVKIRGFRVE      5640
     LGEIDSVFRA HSAVGFAATI AHDTESGVTA LVTYVCAASG NDVDVDDLTA FVGGVLPAHM      5700
     VPGSIMVLDS IPLTPAGKLD RRALPEPVFV SHTRFTAPDT ADEIAVAAAF ADVLGESRIG      5760
     VDDNFFALGG NSLSATQVVS RVGSAFGTRV SVRTLFDNPT VRQLVSAVAT SGPDASSGRP      5820
     ALTRREHPGR IPLSLAQQRI WFLNQYDPSS SAYNIPLALR MSGRIDVPAL RAALGDVLER      5880
     HESLRTVYPG SADGAHQEIL PAAAAEFDLT PIRTAPDQLM LRIAEYAVAG FDVTREIPFR      5940
     IHLFRENRSE HVLLLVAHHI AADGWSFGPL AADVMAAYAS RVEGLAPSWE PLPVQYADYS      6000
     VWQRELLGAE DDPDSLSATQ IERWRAALDG APEALDLPTD HPRPAVASHR GERVDFEIDA      6060
     DTHRGLVERA QKGGTTLFMV VHAAFATLLH RLSGSTDIVI GTPVAGRGDE GLDPLVGMFV      6120
     NTLALRTRID PGESIDALLE QVRDVDLTAF QDTEVPFDRL VEILRPTRSS DRHPLFQVMF      6180
     AFQNLRPVTM ELPQLVVEAV DFDPHIAKFD LDLALAEIVD DAGHHHGISG AFTFASELFE      6240
     RATVAGFADR FLRILEAVAS ADDIAVGDIA ILGAAEQGSL APVWGGPLLA NATLPELLVA      6300
     TAERYPDSTA VVFDGVSIDY RELDRRSTQL ARALIGMGVG PETYVALALP RSVESVLCVW      6360
     AAAKTGAAYV PIDPAHPADR IAHILRDSGV VVGVTCAEFA EHLPGVTDWL VLDDPAVLRE      6420
     LSSASTAPVG DADRTSALHV DHPAYLIYTS GSTGLPKGVV VSHRGLANLA GSYTTAVRAT      6480
     EESRVAHLAS PTFDLSVLEL LLAHTSGAAL VVCPPGVYGG VELHEVLQSE RVTHMTITNA      6540
     ALASVEPEGL DDLRSIVVGG DACPPETVAR WADRLELVNG YGPTEVTVGA TFSSVLGQGR      6600
     DITIGGPLPG VAAVVLDSRL RPVPVGVVGE LYLLGPALAR GYHERAALTA HRFVASPFEA      6660
     AGARMYRTGD IVRWRAVHSG VTGSMTDGTF PGHAIEYLGR SDHQVKVRGL RIELGEIDAA      6720
     LNAHPDVEFA ATLGYESPAE TRLASHVLVG AGADRDPAAL LAFLRQALPG YMVPSALVFL      6780
     DTIPLTPNGK LDRDALPAPD FGAAAKEIVY REPRNPLEQS IADAFAEVLG GTDIGLDTDF      6840
     FDAGGNSLSA TRVTARVGAL LDIRVTVRDL FEAPTVLALA ESLAPRMSEA GDGASAGPAL      6900
     APQPRPDRIP LSLAQQRMWF LNQFETSSPA YNLPAAVRLT GPLDTAALAA AIDDLITRHE      6960
     SLRTVFPDSR GGPHQVILEP GQFTPDTAPV RVSESGLRAD LEQFLLTGFD VSQAVPLRVK      7020
     VYSLGDTEHV LAFVVHHIAA DGVSMEPLIR DVMIAYSSRA AGHAPSWAPL PVQYADYALW      7080
     QREVLGVESD PGSLAAAQLE YWTRTLAGVP DQLYLPGDRG RPAVPSHRGA ATRFTLDADT      7140
     HRALAELARA HGASIFMVAH AALSVLLGRL STSSDITVGT AIAGRGRVEL DDIIGMFVNT      7200
     LVLRTTLDPG ASFVSLLEQA RDVDLEAFAH ADLPFERLVE VLSPVRSTSH HPLFQVALGV      7260
     QAVSADRLEL DGLSLEPLTL DASTAKFDLH FTLTERLDDA SEAAGIDAEL VYATDIFDES      7320
     TAAEYAIRLR RIFEAVVADP QRPIGDIPVL GDEEYAALTP VRGADARPVQ MLPEILADAV      7380
     AAAPDGPAVV FEGESLTYRD LDERSNQLAR LLVDRGVGPE TRVALALPRS LESVVAVWAV      7440
     AKTGAAFVPV DPGYPADRVL HMVQDSGAMV GITVSAKQDV LPDSIRWMLL DDPALAVRCT      7500
     HESRLPLTNR DRMRPILSDQ VAYVIYTSGS TGRPKGVAVT HRGLMNLVTD ERELLGVTSG      7560
     SRTLHFASPS FDASVFEMLM ALGAGATMVI APPTIYGGSE LAELLAAEHV THAFSTPAAL      7620
     ASVDHHGLDD LAVVVVAGDV CPPELVARWA PGRRMVNAYG PSEATIMSSI TEPLRAGEPV      7680
     TIGGPSRGVR ALVLDGRLRP VPVGVPGELY VGGPSLARGY LGRPGLTAER FVADPYGEPG      7740
     DLMYRTGDLV RWRENRVLDF VGRTDHQVKI RGFRIELGEI DAALTAHPQI EYATTIGYEH      7800
     PNGETSLVAY VLPFTGEDVD RVEVANFVGR TLPAYMVPAS VTLLDALPLT PAGKLDRAAL      7860
     PEPIFVAAAT TFEAPRNPME VIVAGIFADI LALPEIGIHD SFFDLGGNSL LATQVVSRIN      7920
     AALDVHVGVR EVFESPTVAA LAARITETTT HGVRRPALTA KPRPEHIPLS LAQQRMWFIN      7980
     QFDTASPAYN LPVALRLSGE VDLRAMQIAI ADLVGRHEAL RTVYPDSVDG PHQVIVPAGD      8040
     AVPDLTPVAA HPDDVLDRVL ALVTTGFDVT ADVPLRARMY RVGADDYVLV MVAHHISGDG      8100
     WSLAPLARDV MLAYTARAEG HVPRWTPLPV QYADYSLWQR ELLGDETDPE SVAAAQIAYW      8160
     TRTLEGLPDR PSLPTDRPRP AVASHLGAHV PFTIDAGTHR ALLALARGRN TSLFMVMHTA      8220
     LAVLLARLSN ESDIAVGAPI AGRGEESLDE LVGMFVNTLV LRTRVALASS FADSLADVRS      8280
     ADLNAFAHSD IPFERLVDVL NPARSRAHHP LFQVAFSFQN LATTTLELPG LHVEGLDVPN      8340
     TISNFDLHLT LSEKHDADGS PDVIEAQFTY ATDLFDESTV RAFAERFTRV LASVVEDPDV      8400
     AVGAIDLLDG PERQSIVADF NDTGVDLPPT TLAELFSAQA ARTPEKAAVF FEGTELTYAE      8460
     FDRRVDVLAH RLIDRGVGPE SVVGLAMNRS IELLVGMYAV LRAGGAYLPI DLTHPADRLA      8520
     YVLATARPVC ILTTSSDGFA AESVPVIEID TLDHTGSPRE PVTDARRLAP LRPENTAYLI      8580
     FTSGSTGRPK GVAVTHAAIA NQLRWKQHEY SLDTTDAVVQ KTPVTFDLSV WELFWPLTTG      8640
     ARLVIARPDG HRDPAYLADL MRQQRVTTAH FVPSLLEAFL ATPDAGEQPA LRRVLCIGEA      8700
     LPVDTAARFR RRFGTVALHN LYGPTEAAVS VTAWTHTADD VDTVPIGGPE WNTQVFVLDA      8760
     RLNPVPVGVA GELYLAGEQL ARGYVARADL TAERFVANPF GASGSRLYRT GDVVRWHVRD      8820
     SRGVLEYLER SDFQVKVRGF RIELGEIESA LVSSAGVGQA VVVAHQHPHT GTTLIGYVVP      8880
     EDGATVDFAA VLAEVGAAVP SYMVPAALVV LAQLPLTSNG KLDRRALPAP DFASATDEYR      8940
     APATPTEEAV AAVFADVLGV DQVGTAANFF DLGGNSLVAT RVVARLSERL GCRVEIRTLF      9000
     EAPTVAALAA LLDSIDATAP ARPALTPAVR PERIPLSSAQ HRMWFLNRFD PNSAVHNIPA      9060
     AVRLSGALDV DALQHAVADV VRRHESLRTV YPDSADGPHQ VILPIDRVGG EMSVVATDEA      9120
     ALPALIAGLV TTGFDVTTEV PVRVRIFRMS ATEHVLALVV HHISGDGWSM APMVRDVMTA      9180
     YAARSADTTP DWAPLPVQYA DYALWQRALL GDETDPESVS ARQLAFWTHT LAGAPDQLDL      9240
     PTDRPRPAVA SYRGGTVDFT VPADLHGTLL GAARDANASL FMLVHAALAV LLSRLSGTGD      9300
     IAIGTPVAGR GERELDDLIG MFVNTLVLRQ QVDGGRTFAE LVADVRETDL AAFSHADVPF      9360
     ERLVEVVNPS RSTGRHPLFQ VMLTFQNLDQ ATLRLGDLSV SGVDFDVDIA KFDLQLTLME      9420
     QFDSAGSPDG IAARLTYASD LFDEPSMHVF GQRFQQVLRA ATDSPDTAVG DIDVLGSGER      9480
     KQIAGTNATS HEVPAGTLAS LFDTRVAADP VRVAVIFDRD ELTYADFDAR VNRLARRLIE      9540
     QGVGPESVVA VAMRRSIDLL VAIYAVVKAG GAYLPVDPDH PAERTAHVLD TAQPACVLVS      9600
     GAGLAGGGSV PVIDVASEDV SGFDSSPVTD ADRLWPLSPA NTAYVIFTSG STGRPKGVAV      9660
     THGAIVNRLL WMQHEYTLTS ADVVLQKTPV TFDVSVWELF WPLQVGASLV IAAPDGHRDP      9720
     RYLTGLIQER HVTTTHFVPS MLSVFTAEPA VAVCDSLRLV FCSGEALTPE QVSRFRAVCG      9780
     ADLHNLYGPT EAAVDVTYWE TGAADTVTVP IGRPVWNTQV HVLDSRLHPV PNGVAGELYL      9840
     AGDQLARGYL NRPDLSADRF VANPHVAGGR MYRTGDLVRR RADGVLEYVG RTDFQVKLRG      9900
     QRIELGEIEA ALEAHPDVSQ AVVVVHRDDR GEEALVAYLV GPRAADWSDV RAHLSARVPS      9960
     YMIPAQVVHL DTLPLSANGK LDRTALPAPA ARSAADEYQA PRTAAERAVA TVFADVLGID     10020
     RVGVTDSFFD LGGNSLIATR VASALGSELG IDFPLQWMFS DPTPQSLGQR IQKWTNDGVD     10080
     GAGASLDVLL PIRTRGTAEP LFCVHPFIGL AWSYAGLGRE LTQDRPIYGL QSPALTEDEP     10140
     HLETITDFAA RYVREIRSIQ PHGPYHLVGW SLGGVIAHEM GVQLQDAGEE VRLLGLLDSY     10200
     VGIDRSVENS ATTADLLGGV GLDLPDDSVL DELAPDGQFD AERAAALLRV VGGPLAALTA     10260
     TELERIYGNA LRAPALIDAH RPRVFDGELV FFTAALDDGF HVDPVTCWGQ FVRGSIDEHP     10320
     VDATHWTMTT PDALAAIAPH LERSHRRPRH AAPDTGRDSD PDDSANRPHS VR             10372
//

If you have problems or comments...

PBIL Back to PBIL home page