(data stored in ACNUC7421 zone)

EMBL: CP000431.PE145

CP000431.PE145       Location/Qualifiers
FT   CDS             complement(204228..204956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00145"
FT                   /product="dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0016410 - N-acyltransferase activity;
FT                   GO_function: GO:0016810 - hydrolase activity, acting on
FT                   carbon-nitrogen (but not peptide) bonds; GO_process:
FT                   GO:0006807 - nitrogen compound metabolism; GO_process:
FT                   GO:0042158 - lipoprotein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91981"
FT                   /db_xref="GOA:Q0SKF5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF5"
FT                   /protein_id="ABG91981.1"
FT                   /translation="MIIPTYNERENLGLIVGRLHAALPRTHVLVVDDGSPDGTGDVADA
FT                   LASSDDASRIHVMHRTEKNGLGAAYIAGFHWGLDRDYTVLVEMDADGSHAPEQLHRLLD
FT                   QVDAGADLVLGSRYVPGGTVVNWPKHREWLSRGGNIYSRLALGVKIKDITGGYRAYRRE
FT                   VLEKLDLAAVESHGYCFQVDLAWRAIQEGFDVREVPITFTEREIGESKMSGGIVREALL
FT                   KVTQWGLRNRIAKLKGAAAR"
     MIIPTYNERE NLGLIVGRLH AALPRTHVLV VDDGSPDGTG DVADALASSD DASRIHVMHR        60
     TEKNGLGAAY IAGFHWGLDR DYTVLVEMDA DGSHAPEQLH RLLDQVDAGA DLVLGSRYVP       120
     GGTVVNWPKH REWLSRGGNI YSRLALGVKI KDITGGYRAY RREVLEKLDL AAVESHGYCF       180
     QVDLAWRAIQ EGFDVREVPI TFTEREIGES KMSGGIVREA LLKVTQWGLR NRIAKLKGAA       240
     AR                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page