(data stored in ACNUC7421 zone)

EMBL: CP000431.PE146

CP000431.PE146       Location/Qualifiers
FT   CDS             complement(204937..206640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00146"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0016410 - N-acyltransferase activity;
FT                   GO_function: GO:0016810 - hydrolase activity, acting on
FT                   carbon-nitrogen (but not peptide) bonds; GO_process:
FT                   GO:0006807 - nitrogen compound metabolism; GO_process:
FT                   GO:0042158 - lipoprotein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91982"
FT                   /db_xref="GOA:Q0SKF4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF4"
FT                   /protein_id="ABG91982.1"
FT                   /translation="MSGSTTPRWTIGKLGVLVRSVLSVAAGFLVFAGFPPRPLWFLAPI
FT                   GIALLTLILTGAGGAAPRLRAGFGYGYLAGLGFLVPLLPWIGVFVGALPWLALAAVESL
FT                   YIGLFGVLAVLVSRLRWAPLWIAACWSLTEWLRASVPFGGFPWGRLAFGQSEGWFLPLA
FT                   SIGGAPLLSFAVALTGAGLASVAVTVRARASGATNWTRPLAGGLVAALAATVVSLALWP
FT                   TPPGMDSGDRTITVAAIQGSVPKLGLDFNDQRKRVLDNHVNRTLELADDVASGAAPQPD
FT                   LVVWPENASDIDPLRNADAAADISRASEAIGAPILVGAVLVNSDRTTTNSVIVWDGDAG
FT                   PQEQHDKKIIQPFGEYLPYRGFFRHFSAYADRAGNFVPGDGDGVVHADGIAVGVATCYE
FT                   VAFDRAFEQSVRSGAELLAVPTNNATFGDTEMTYQQLAMSQVRAVEHGRAVVVAATSGV
FT                   SAIISPDGSTAAETSLFVPAALVSQVPLRTGTTLASRLGPIPEVLLCVGAVAAVAFAVV
FT                   QRRRTVRTLIQRSTEKAPAVAGREDPHGIGDRFRAERGTERTDSGDHSDV"
     MSGSTTPRWT IGKLGVLVRS VLSVAAGFLV FAGFPPRPLW FLAPIGIALL TLILTGAGGA        60
     APRLRAGFGY GYLAGLGFLV PLLPWIGVFV GALPWLALAA VESLYIGLFG VLAVLVSRLR       120
     WAPLWIAACW SLTEWLRASV PFGGFPWGRL AFGQSEGWFL PLASIGGAPL LSFAVALTGA       180
     GLASVAVTVR ARASGATNWT RPLAGGLVAA LAATVVSLAL WPTPPGMDSG DRTITVAAIQ       240
     GSVPKLGLDF NDQRKRVLDN HVNRTLELAD DVASGAAPQP DLVVWPENAS DIDPLRNADA       300
     AADISRASEA IGAPILVGAV LVNSDRTTTN SVIVWDGDAG PQEQHDKKII QPFGEYLPYR       360
     GFFRHFSAYA DRAGNFVPGD GDGVVHADGI AVGVATCYEV AFDRAFEQSV RSGAELLAVP       420
     TNNATFGDTE MTYQQLAMSQ VRAVEHGRAV VVAATSGVSA IISPDGSTAA ETSLFVPAAL       480
     VSQVPLRTGT TLASRLGPIP EVLLCVGAVA AVAFAVVQRR RTVRTLIQRS TEKAPAVAGR       540
     EDPHGIGDRF RAERGTERTD SGDHSDV                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page