(data stored in ACNUC7421 zone)

EMBL: CP000431.PE147

CP000431.PE147       Location/Qualifiers
FT   CDS             complement(206630..208234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00147"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91983"
FT                   /db_xref="GOA:Q0SKF3"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF3"
FT                   /protein_id="ABG91983.1"
FT                   /translation="MPVTTQLLVGGRIYSSFAPDATSMAVTGGVVSWVGDDRAARALHP
FT                   GADVVDLGGAFVTPAFVDTHVHLTALGLNIVGLDLVGVGSLRECLDRLASFARTHGDAV
FT                   IWGHGWDESAWPEGAGPTTAQLDEAAPGRTVYLSRIDVHSAVCSTALRQSVPDLSDTAG
FT                   FSPEGPLTFEAHHAARTVARSLLTAEQRSAARTAALDAIASRGIVAVHECGGPDIAGLD
FT                   DFRELLATPHGVEVRGYWGEAVTDADEARKLLNATGAHALGGDLFIDGSLGSHTAWLSE
FT                   PYADLDGGTGKSYLGVDEIAAHVRACTIAGIQAGFHVIGDAAVRAAVDAFAVVAADLGG
FT                   PAVAKAGHRLEHVEMMTGDDAARLAQWGVIASVQPAFDALWGGTDGLYAQRLGTERALT
FT                   LNPFAAAASAGVSLALSSDAPVTPVDPWAMLRAAVHHRTPGSGISPRAAFSAATRGAWR
FT                   AGGVRDGLAGTLDPGAPASYAVWDAGELVVSAPKDSVQRWSTDPRSRVPALPRLEDDAP
FT                   TPVLLRSVHRGSVVHER"
     MPVTTQLLVG GRIYSSFAPD ATSMAVTGGV VSWVGDDRAA RALHPGADVV DLGGAFVTPA        60
     FVDTHVHLTA LGLNIVGLDL VGVGSLRECL DRLASFARTH GDAVIWGHGW DESAWPEGAG       120
     PTTAQLDEAA PGRTVYLSRI DVHSAVCSTA LRQSVPDLSD TAGFSPEGPL TFEAHHAART       180
     VARSLLTAEQ RSAARTAALD AIASRGIVAV HECGGPDIAG LDDFRELLAT PHGVEVRGYW       240
     GEAVTDADEA RKLLNATGAH ALGGDLFIDG SLGSHTAWLS EPYADLDGGT GKSYLGVDEI       300
     AAHVRACTIA GIQAGFHVIG DAAVRAAVDA FAVVAADLGG PAVAKAGHRL EHVEMMTGDD       360
     AARLAQWGVI ASVQPAFDAL WGGTDGLYAQ RLGTERALTL NPFAAAASAG VSLALSSDAP       420
     VTPVDPWAML RAAVHHRTPG SGISPRAAFS AATRGAWRAG GVRDGLAGTL DPGAPASYAV       480
     WDAGELVVSA PKDSVQRWST DPRSRVPALP RLEDDAPTPV LLRSVHRGSV VHER             534
//

If you have problems or comments...

PBIL Back to PBIL home page