(data stored in ACNUC7421 zone)

EMBL: CP000431.PE148

CP000431.PE148       Location/Qualifiers
FT   CDS             complement(208247..208753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00148"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91984"
FT                   /db_xref="GOA:Q0SKF2"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF2"
FT                   /protein_id="ABG91984.1"
FT                   /translation="MYAALFLLYVVVEIAALVLVGHAIGVLWTVLLLLGGTLIGLLLMR
FT                   SQWRRVMDGLRRAASGDGSPGAAVADGALVALGSALMFVPGLVTSVLGLLFLVPPTRWA
FT                   LRPVVVLLAGRRAATVAAGAEAFARAPRRGRGEVIEGEVVDEVFEGEVIDEEPRTPTRD
FT                   PHVLP"
     MYAALFLLYV VVEIAALVLV GHAIGVLWTV LLLLGGTLIG LLLMRSQWRR VMDGLRRAAS        60
     GDGSPGAAVA DGALVALGSA LMFVPGLVTS VLGLLFLVPP TRWALRPVVV LLAGRRAATV       120
     AAGAEAFARA PRRGRGEVIE GEVVDEVFEG EVIDEEPRTP TRDPHVLP                    168
//

If you have problems or comments...

PBIL Back to PBIL home page