(data stored in ACNUC7421 zone)

EMBL: CP000431.PE149

CP000431.PE149       Location/Qualifiers
FT   CDS             208958..209575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF1"
FT                   /protein_id="ABG91985.1"
FT                   /translation="MTRSTVFRRAAIVLASAAAFGMLSTGPASAAPVADFAKGAAELQA
FT                   LATEVSPAATAAVDALLGASVFIPKDVLEVGLTTPQDFMYPSPTLGCGVADKPATVTLA
FT                   SAQGGPNLFPQISPNQLRFQAVPAYVAIPQSSDLSVAWINLTTFQGGIVKLDDKLPLIN
FT                   TPLLSKVVDTGKGTVLATMFGTVGYADSVTCTVVPTVGTFTV"
     MTRSTVFRRA AIVLASAAAF GMLSTGPASA APVADFAKGA AELQALATEV SPAATAAVDA        60
     LLGASVFIPK DVLEVGLTTP QDFMYPSPTL GCGVADKPAT VTLASAQGGP NLFPQISPNQ       120
     LRFQAVPAYV AIPQSSDLSV AWINLTTFQG GIVKLDDKLP LINTPLLSKV VDTGKGTVLA       180
     TMFGTVGYAD SVTCTVVPTV GTFTV                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page