(data stored in ACNUC7421 zone)

EMBL: CP000431.PE154

CP000431.PE154       Location/Qualifiers
FT   CDS             212195..213754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00154"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91990"
FT                   /db_xref="GOA:Q0SKE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE6"
FT                   /protein_id="ABG91990.1"
FT                   /translation="MSTGLLNEPLERSAPPPVPRPFRAPMILAASGAVVAAVLFWIVSG
FT                   SLTDDAYISLSAARNLAVHGEWAIVHGLTANTSTSPLNVLVLGALTFLTRLWGPGDPLL
FT                   ALGMLNVAVTALLGWVLARMCRRLGLGSGWAVLAGALVVFNPFVLSAVGLEVLLIPAAV
FT                   AVMVWFAVEGRTAWFGAAAGMATLVRLDLLVFVVVIAALSPVIRTQLRRALAGFAAIAG
FT                   PWYLFSWVVLGSALPDTFLIKQGQASDVGGYNYLTGPIMYFESNPWRTVAAFGPAALAL
FT                   VLILVALASYARPWKRPVPVPVPLLALGLSGALYYVAYVVLDTVPYHWYYVAPATTLAM
FT                   FAVLAAGIHWSAARDTPDRAVAGSLAGLLAVLGVGAVYYDVESGLPWDAPPIFGNWASA
FT                   QDYERVGRAVGTLVGEAPVRSPGEIGTLAYFCECVIVDEFSDRGLVVEDRLVPRLAEAT
FT                   EPARTLLRANYVFFDYRLAPVNPAFDLRYEEGRGPGGPMSWDVFSAARGAGHFILVPLT
FT                   AG"
     MSTGLLNEPL ERSAPPPVPR PFRAPMILAA SGAVVAAVLF WIVSGSLTDD AYISLSAARN        60
     LAVHGEWAIV HGLTANTSTS PLNVLVLGAL TFLTRLWGPG DPLLALGMLN VAVTALLGWV       120
     LARMCRRLGL GSGWAVLAGA LVVFNPFVLS AVGLEVLLIP AAVAVMVWFA VEGRTAWFGA       180
     AAGMATLVRL DLLVFVVVIA ALSPVIRTQL RRALAGFAAI AGPWYLFSWV VLGSALPDTF       240
     LIKQGQASDV GGYNYLTGPI MYFESNPWRT VAAFGPAALA LVLILVALAS YARPWKRPVP       300
     VPVPLLALGL SGALYYVAYV VLDTVPYHWY YVAPATTLAM FAVLAAGIHW SAARDTPDRA       360
     VAGSLAGLLA VLGVGAVYYD VESGLPWDAP PIFGNWASAQ DYERVGRAVG TLVGEAPVRS       420
     PGEIGTLAYF CECVIVDEFS DRGLVVEDRL VPRLAEATEP ARTLLRANYV FFDYRLAPVN       480
     PAFDLRYEEG RGPGGPMSWD VFSAARGAGH FILVPLTAG                              519
//

If you have problems or comments...

PBIL Back to PBIL home page