(data stored in ACNUC7421 zone)

EMBL: CP000431.PE155

CP000431.PE155       Location/Qualifiers
FT   CDS             complement(213835..214500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91991"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE5"
FT                   /protein_id="ABG91991.1"
FT                   /translation="MSNQYRCRSLIFARRQPAQMHGAFAVVEHSDRLAQRVPGIVELRA
FT                   IGDLSRESIEPTCRQPKSNPWVPTDVPHPAGDEIRARHRQRGWQKRDEVGTVTALDHPH
FT                   TLSSLFARLASSRRQYCKSRRRAHEEAGQHQGTEDCPVPRPPHQAPVLGRLLRRRSADL
FT                   PVPLVIIRRGRSILVSCHSHRPVPAFPASNMATVHRSTRRHFTCQATKNRAPCRSSGS"
     MSNQYRCRSL IFARRQPAQM HGAFAVVEHS DRLAQRVPGI VELRAIGDLS RESIEPTCRQ        60
     PKSNPWVPTD VPHPAGDEIR ARHRQRGWQK RDEVGTVTAL DHPHTLSSLF ARLASSRRQY       120
     CKSRRRAHEE AGQHQGTEDC PVPRPPHQAP VLGRLLRRRS ADLPVPLVII RRGRSILVSC       180
     HSHRPVPAFP ASNMATVHRS TRRHFTCQAT KNRAPCRSSG S                           221
//

If you have problems or comments...

PBIL Back to PBIL home page