(data stored in ACNUC7421 zone)

EMBL: CP000431.PE156

CP000431.PE156       Location/Qualifiers
FT   CDS             complement(214594..215322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00156"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0016566 - specific
FT                   transcriptional repressor activity; GO_process: GO:0006355
FT                   - regulation of transcription, DNA-dependent; GO_process:
FT                   GO:0016481 - negative regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91992"
FT                   /db_xref="GOA:Q0SKE4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE4"
FT                   /protein_id="ABG91992.1"
FT                   /translation="MAKQVVSDSSRKRRRPTKQGAVLSEQLIMETALRLLRHHGSAGLS
FT                   VRRLGAALGADPSTLYRYFRGIDDLTLAIADELIGRSFHGWEPTGDWWRDLHSLGIRSH
FT                   AAYLDHPQAAVLSASRVSGRTSEKAAVDTILGVLREAGFPDGAAVRLYRAFVDQMLAFA
FT                   ALDGAELALPDDVRESDRQLWRSSYAQLPAETHPHIAATAGLLVDLSDRSAYPDALELL
FT                   LDGARALLHRLDAKRESATS"
     MAKQVVSDSS RKRRRPTKQG AVLSEQLIME TALRLLRHHG SAGLSVRRLG AALGADPSTL        60
     YRYFRGIDDL TLAIADELIG RSFHGWEPTG DWWRDLHSLG IRSHAAYLDH PQAAVLSASR       120
     VSGRTSEKAA VDTILGVLRE AGFPDGAAVR LYRAFVDQML AFAALDGAEL ALPDDVRESD       180
     RQLWRSSYAQ LPAETHPHIA ATAGLLVDLS DRSAYPDALE LLLDGARALL HRLDAKRESA       240
     TS                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page