(data stored in ACNUC7421 zone)

EMBL: CP000431.PE157

CP000431.PE157       Location/Qualifiers
FT   CDS             215391..217022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00157"
FT                   /product="amino acid transporter, APC family protein"
FT                   /note="tc: 2.A.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0005279 - amino acid-polyamine
FT                   transporter activity; GO_process: GO:0006865 - amino acid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91993"
FT                   /db_xref="GOA:Q0SKE3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE3"
FT                   /protein_id="ABG91993.1"
FT                   /translation="MSQAGSEAPGRGHETPDRRVASRPSPPSSESDAHMAVVNNGAADA
FT                   PRATALRKSLGVMDGVAIAASSTAATTSIGVGLGVIAAVVGLQMPVVLLLAFVPILGIA
FT                   SGYARLNRVEPNCGNSYVWVGRSLSPWLGFLTGWMAIVAVVVFMAYTTAIAGSAILQLA
FT                   GMAGLHSIGGLALDPDSTLQSTMLGLTILGAVTFTAVRGVAVAARLQKYLLVFEYVVLI
FT                   GFCTYGLFAGSQPFSLSWFNPFAIPSFAVLAEGMVIAVFFYWGFEAAFSVSEEVRDPRD
FT                   ASRAGVITVFLVLGLFLLGAVAFQRVLTPTELADNGTVGLAFLGEALARQPLAALPVVA
FT                   LMFSVIASLQATVIPSARGLFAMGRDRTLGPVWTRIHSRYGTPAAGTVLLGGISAVVAL
FT                   LATVIPKLSDLLGAGISSIGLVVALWYGLTALAAAVRFRGLLRERPWEGLRAVVFPALS
FT                   ALVLLALGGYLGWIFYTSADHLEFSATNGWFQLLFPVLILISGLVVAAHAKWVRRSPYF
FT                   VTGRGTDADDVNLLGAPADVPVTTRS"
     MSQAGSEAPG RGHETPDRRV ASRPSPPSSE SDAHMAVVNN GAADAPRATA LRKSLGVMDG        60
     VAIAASSTAA TTSIGVGLGV IAAVVGLQMP VVLLLAFVPI LGIASGYARL NRVEPNCGNS       120
     YVWVGRSLSP WLGFLTGWMA IVAVVVFMAY TTAIAGSAIL QLAGMAGLHS IGGLALDPDS       180
     TLQSTMLGLT ILGAVTFTAV RGVAVAARLQ KYLLVFEYVV LIGFCTYGLF AGSQPFSLSW       240
     FNPFAIPSFA VLAEGMVIAV FFYWGFEAAF SVSEEVRDPR DASRAGVITV FLVLGLFLLG       300
     AVAFQRVLTP TELADNGTVG LAFLGEALAR QPLAALPVVA LMFSVIASLQ ATVIPSARGL       360
     FAMGRDRTLG PVWTRIHSRY GTPAAGTVLL GGISAVVALL ATVIPKLSDL LGAGISSIGL       420
     VVALWYGLTA LAAAVRFRGL LRERPWEGLR AVVFPALSAL VLLALGGYLG WIFYTSADHL       480
     EFSATNGWFQ LLFPVLILIS GLVVAAHAKW VRRSPYFVTG RGTDADDVNL LGAPADVPVT       540
     TRS                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page