(data stored in ACNUC7421 zone)

EMBL: CP000431.PE159

CP000431.PE159       Location/Qualifiers
FT   CDS             218855..219259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91995"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE1"
FT                   /protein_id="ABG91995.1"
FT                   /translation="MGDNRPFGFDPDDLDRVIREAGEELQGVKDRIVRFLDQADSQIPW
FT                   TGVFADFARSPRGAAKPETAGETGDGVWAIYTLDDEGVARVEQVYATELDALRAHKHNT
FT                   DPHRSVRFLPYGVTVSVLDQPEEAAPPETE"
     MGDNRPFGFD PDDLDRVIRE AGEELQGVKD RIVRFLDQAD SQIPWTGVFA DFARSPRGAA        60
     KPETAGETGD GVWAIYTLDD EGVARVEQVY ATELDALRAH KHNTDPHRSV RFLPYGVTVS       120
     VLDQPEEAAP PETE                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page