(data stored in ACNUC7421 zone)

EMBL: CP000431.PE16

CP000431.PE16        Location/Qualifiers
FT   CDS             25986..26459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91852"
FT                   /db_xref="GOA:Q0SKT4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT4"
FT                   /protein_id="ABG91852.1"
FT                   /translation="MSTVSGLPAHVLLVHFIVVLAPLTAVLIVVCSVWPAARRRLVWLT
FT                   LVLAAVTVIVTPLTTDAGEWLEKHVARSSAVHTHAELGDSMIYFSVALLLSALAVTAVQ
FT                   LRERKSDPPRSLTVIVAVLAVVVAVGTIVQVYRIGESGSRATWGDVVTSGSEP"
     MSTVSGLPAH VLLVHFIVVL APLTAVLIVV CSVWPAARRR LVWLTLVLAA VTVIVTPLTT        60
     DAGEWLEKHV ARSSAVHTHA ELGDSMIYFS VALLLSALAV TAVQLRERKS DPPRSLTVIV       120
     AVLAVVVAVG TIVQVYRIGE SGSRATWGDV VTSGSEP                                157
//

If you have problems or comments...

PBIL Back to PBIL home page