(data stored in ACNUC7421 zone)

EMBL: CP000431.PE160

CP000431.PE160       Location/Qualifiers
FT   CDS             complement(219270..220439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00160"
FT                   /product="receptor-like histidine kinase of 2 component
FT                   system"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0000155 - two-component sensor activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0046983 - protein dimerization activity; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation; GO_process: GO:0007600 - sensory
FT                   perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91996"
FT                   /db_xref="GOA:Q0SKE0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE0"
FT                   /protein_id="ABG91996.1"
FT                   /translation="MHMRRFSLWLRGKPTVADSMLAAILFTLEVFVFTASGDRSPWVQL
FT                   VMGFLLCLPIVWRRKYPLAAAGAVLVMSITITFISYSIGDLDAEHPGLLALAVALYTLV
FT                   AYVDRSTAAVYAVGLVVDSALSIWLLEQELVAAGLFSVLVFALSWITAEFLGARRAYDE
FT                   EVAARLVVADYDRDRRAEDAVAAERTRIARELHDVVAHAVSVMIVQADGASYALKTNPD
FT                   IAKQALTNIASTGREALAELRRTVSLLRTEPATDDMPQHGTAGLARVVDMMRSAGLPVE
FT                   LELTGELDDISPAVSLGVHRLVQESLTNVLRHAGERPRAKVRVRRRETDVLVEITDNGN
FT                   SSGQFSLGSGNGLLGMRERVAVLHGTLEAGRQTDGSWRVTAELPLELED"
     MHMRRFSLWL RGKPTVADSM LAAILFTLEV FVFTASGDRS PWVQLVMGFL LCLPIVWRRK        60
     YPLAAAGAVL VMSITITFIS YSIGDLDAEH PGLLALAVAL YTLVAYVDRS TAAVYAVGLV       120
     VDSALSIWLL EQELVAAGLF SVLVFALSWI TAEFLGARRA YDEEVAARLV VADYDRDRRA       180
     EDAVAAERTR IARELHDVVA HAVSVMIVQA DGASYALKTN PDIAKQALTN IASTGREALA       240
     ELRRTVSLLR TEPATDDMPQ HGTAGLARVV DMMRSAGLPV ELELTGELDD ISPAVSLGVH       300
     RLVQESLTNV LRHAGERPRA KVRVRRRETD VLVEITDNGN SSGQFSLGSG NGLLGMRERV       360
     AVLHGTLEAG RQTDGSWRVT AELPLELED                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page