(data stored in ACNUC7421 zone)

EMBL: CP000431.PE161

CP000431.PE161       Location/Qualifiers
FT   CDS             220480..221247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00161"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91997"
FT                   /db_xref="GOA:Q0SKD9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD9"
FT                   /protein_id="ABG91997.1"
FT                   /translation="MNVGDWALLLTAATAAGWVDAVVGGGGLILIPALFLVAPQLTPQA
FT                   ALATNKLTAFTGTSAAVVTFARRIPMNWRLLVPAGLLAAVASALGAATVSRIDKDVFIP
FT                   LIMAVLVGVAVFVTIRPQLGTTLAKDPPTRRKVVAVVLLSAGLLGFYDGLFGPGTGTFL
FT                   IISFATFLGTEFVRSAAMAKVINLGSNLGALVFFAATGHVLWALGLGMAVCNVIGAVIG
FT                   SRMALSKGAGFVRITLLIVVIAMVIRLGWQQFG"
     MNVGDWALLL TAATAAGWVD AVVGGGGLIL IPALFLVAPQ LTPQAALATN KLTAFTGTSA        60
     AVVTFARRIP MNWRLLVPAG LLAAVASALG AATVSRIDKD VFIPLIMAVL VGVAVFVTIR       120
     PQLGTTLAKD PPTRRKVVAV VLLSAGLLGF YDGLFGPGTG TFLIISFATF LGTEFVRSAA       180
     MAKVINLGSN LGALVFFAAT GHVLWALGLG MAVCNVIGAV IGSRMALSKG AGFVRITLLI       240
     VVIAMVIRLG WQQFG                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page