(data stored in ACNUC7421 zone)

EMBL: CP000431.PE162

CP000431.PE162       Location/Qualifiers
FT   CDS             221270..222790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00162"
FT                   /product="probable modulator of DNA gyrase protein, TldD"
FT                   /note="GO_component: GO:0042597 - periplasmic space;
FT                   GO_function: GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91998"
FT                   /db_xref="GOA:Q0SKD8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD8"
FT                   /protein_id="ABG91998.1"
FT                   /translation="MTAPRQVDPEFLALPLRSLADAALAAARAAGASHADLRVHRLTSQ
FT                   SLRLRDGEVQSAVDTSELGFAVRVVVDGTWGFASHAELTPATAAATAEQAVAVARALRR
FT                   LNREHVELAAEPVHTDVRWVSDYDVDPFEVPASDKISLLGEYSRRLLASDGVDHVTAGC
FT                   LHVKEQTFYADLAGSSIVQQRVRLHPQLEATTVDQSAGVFETMRTLAPPVGRGWEYVAG
FT                   DGVWNWTDELARIPDLLAEKVKAPTVVPGPTDLVIDPTNLWLTIHESIGHATEYDRAIG
FT                   YEAAYAGTSFATPDKLGTLRYGTPIMHVTADRTERHGLATIGYDDEGVETQSWDLVADG
FT                   ILVGYQLDRAFAPRLGLERSNGCSYADSPHHVPIQRMANVSLQPDPDADRSTDDLISDV
FT                   EDGIYVVGDKSWSIDMQRYNFQFTGQRFYRIRGGKLDGQLRDVAYQATTTDFWGSMDAV
FT                   GGRSTWQLGGAFNCGKAQPGQVAAVSHGCPSALFRGVNVLNTRTEGGR"
     MTAPRQVDPE FLALPLRSLA DAALAAARAA GASHADLRVH RLTSQSLRLR DGEVQSAVDT        60
     SELGFAVRVV VDGTWGFASH AELTPATAAA TAEQAVAVAR ALRRLNREHV ELAAEPVHTD       120
     VRWVSDYDVD PFEVPASDKI SLLGEYSRRL LASDGVDHVT AGCLHVKEQT FYADLAGSSI       180
     VQQRVRLHPQ LEATTVDQSA GVFETMRTLA PPVGRGWEYV AGDGVWNWTD ELARIPDLLA       240
     EKVKAPTVVP GPTDLVIDPT NLWLTIHESI GHATEYDRAI GYEAAYAGTS FATPDKLGTL       300
     RYGTPIMHVT ADRTERHGLA TIGYDDEGVE TQSWDLVADG ILVGYQLDRA FAPRLGLERS       360
     NGCSYADSPH HVPIQRMANV SLQPDPDADR STDDLISDVE DGIYVVGDKS WSIDMQRYNF       420
     QFTGQRFYRI RGGKLDGQLR DVAYQATTTD FWGSMDAVGG RSTWQLGGAF NCGKAQPGQV       480
     AAVSHGCPSA LFRGVNVLNT RTEGGR                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page