(data stored in ACNUC7421 zone)

EMBL: CP000431.PE163

CP000431.PE163       Location/Qualifiers
FT   CDS             222787..224148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00163"
FT                   /product="possible modulator of DNA gyrase protein, TldD"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91999"
FT                   /db_xref="GOA:Q0SKD7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD7"
FT                   /protein_id="ABG91999.1"
FT                   /translation="MIAPQQLVEQVLARATVDETIVIVTDASEASLRWAGNSMTTNGVS
FT                   TSRSWTVISIVRAGEDAKVGIVTSASVDAADIDGVVRSAEIAARAATPASDAMPLLTGT
FT                   EADERWDDSAERTEIGAFEQLAQDLSMGFDGSDQLYGFAHHQLHTTWLGTSTGIRRRFA
FT                   QPTGSVEINGKRGDASAWVGTSTKDFTDVASVKLLQDLSTRLDWARNRVELPAGRYETI
FT                   LPPSAVADLMIYLMWTMEGRAAEEGHSALSAPGGTRIGEKLSALPLTLYSDPAALGLEY
FT                   TPFVVTGSSSESVSVFDNGMDAGRVDWIRDGTVNALAYPRAAAKEFGADVTAPGDNLIL
FT                   DAGGSVSLEQMVAETERGLLLTTLWYIREVDPATLLLTGLTRDGVYLVENGKVTGAVNN
FT                   FRFNESPLDLLRRVTQAGATERTLPREWKDWFTRTAMPALRVPDFHMSSVSKAL"
     MIAPQQLVEQ VLARATVDET IVIVTDASEA SLRWAGNSMT TNGVSTSRSW TVISIVRAGE        60
     DAKVGIVTSA SVDAADIDGV VRSAEIAARA ATPASDAMPL LTGTEADERW DDSAERTEIG       120
     AFEQLAQDLS MGFDGSDQLY GFAHHQLHTT WLGTSTGIRR RFAQPTGSVE INGKRGDASA       180
     WVGTSTKDFT DVASVKLLQD LSTRLDWARN RVELPAGRYE TILPPSAVAD LMIYLMWTME       240
     GRAAEEGHSA LSAPGGTRIG EKLSALPLTL YSDPAALGLE YTPFVVTGSS SESVSVFDNG       300
     MDAGRVDWIR DGTVNALAYP RAAAKEFGAD VTAPGDNLIL DAGGSVSLEQ MVAETERGLL       360
     LTTLWYIREV DPATLLLTGL TRDGVYLVEN GKVTGAVNNF RFNESPLDLL RRVTQAGATE       420
     RTLPREWKDW FTRTAMPALR VPDFHMSSVS KAL                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page