(data stored in ACNUC7421 zone)

EMBL: CP000431.PE165

CP000431.PE165       Location/Qualifiers
FT   CDS             224570..224917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92001"
FT                   /db_xref="GOA:Q0SKD5"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD5"
FT                   /protein_id="ABG92001.1"
FT                   /translation="MTAPRHQRSTTIQEITVSNDVLETAPPAHSIPHRHPDGREVLATA
FT                   KGILIATRGYGDAEAFEELLDVSRHHHVSVMRAAKSLVELATRRQPCPSVTTPAPSYAL
FT                   EFKEWTTLLAR"
     MTAPRHQRST TIQEITVSND VLETAPPAHS IPHRHPDGRE VLATAKGILI ATRGYGDAEA        60
     FEELLDVSRH HHVSVMRAAK SLVELATRRQ PCPSVTTPAP SYALEFKEWT TLLAR            115
//

If you have problems or comments...

PBIL Back to PBIL home page