(data stored in ACNUC7421 zone)

EMBL: CP000431.PE167

CP000431.PE167       Location/Qualifiers
FT   CDS             complement(225020..225544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92003"
FT                   /db_xref="GOA:Q0SKD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92003.1"
FT                   /translation="MTSQLSSSHRYAALDVMRGAAILGTLATNIWIFTNVEGLVGYVNG
FT                   TGRATGGWAPVQAILQQFAQGKFLGLLTIMFGIGLVIQQRSAQRRGARWPGGYPWRAGL
FT                   LMLDGAPGANPARPVGRSREWAALRSVAMCCRTSCARSSATAGDSASRSGWAAPPSCRR
FT                   RSHCSVRSRQP"
     MTSQLSSSHR YAALDVMRGA AILGTLATNI WIFTNVEGLV GYVNGTGRAT GGWAPVQAIL        60
     QQFAQGKFLG LLTIMFGIGL VIQQRSAQRR GARWPGGYPW RAGLLMLDGA PGANPARPVG       120
     RSREWAALRS VAMCCRTSCA RSSATAGDSA SRSGWAAPPS CRRRSHCSVR SRQP             174
//

If you have problems or comments...

PBIL Back to PBIL home page