(data stored in ACNUC7421 zone)

EMBL: CP000431.PE168

CP000431.PE168       Location/Qualifiers
FT   CDS             225624..226208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00168"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92004"
FT                   /db_xref="GOA:Q0SKD2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD2"
FT                   /protein_id="ABG92004.1"
FT                   /translation="MPKLIDHDRRQQEIAEAVWRVIQREGIGAVSVRDVAAEAGISSGS
FT                   LRHVFASKTELLAYSMRLVATRVRERAQAHASITDPWQRALAVLDEVLPLDDRRRCEME
FT                   VNLALVAESPAHPLLKDIALDAQRQLRGACAAILTGLAQWGLIAPDIDVDAEAMRLHAL
FT                   VDGAAMHVLLGDTDTPDTARRMIAEHLRTLL"
     MPKLIDHDRR QQEIAEAVWR VIQREGIGAV SVRDVAAEAG ISSGSLRHVF ASKTELLAYS        60
     MRLVATRVRE RAQAHASITD PWQRALAVLD EVLPLDDRRR CEMEVNLALV AESPAHPLLK       120
     DIALDAQRQL RGACAAILTG LAQWGLIAPD IDVDAEAMRL HALVDGAAMH VLLGDTDTPD       180
     TARRMIAEHL RTLL                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page