(data stored in ACNUC7421 zone)

EMBL: CP000431.PE169

CP000431.PE169       Location/Qualifiers
FT   CDS             complement(226267..226533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92005"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD1"
FT                   /protein_id="ABG92005.1"
FT                   /translation="MNHHIALRRRVDRSMRSRRVNIPRRDAHAVVIAGLLASRVLADYF
FT                   GTVTIHEKDHLADNAVHSIRKRGDLIASRTFDDGVVWLRYRPA"
     MNHHIALRRR VDRSMRSRRV NIPRRDAHAV VIAGLLASRV LADYFGTVTI HEKDHLADNA        60
     VHSIRKRGDL IASRTFDDGV VWLRYRPA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page