(data stored in ACNUC7421 zone)

EMBL: CP000431.PE170

CP000431.PE170       Location/Qualifiers
FT   CDS             complement(226675..227076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92006"
FT                   /db_xref="GOA:Q0SKD0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD0"
FT                   /protein_id="ABG92006.1"
FT                   /translation="MGPVTTEFDRVSSAKYVLLTTFRKDGTPVATPLWAAADGDRLLMW
FT                   TVTDSYKVKRIRRNPEVTVAACDARGKPKGPEVPARAVILDAADTDHTRDVIARKYGIL
FT                   GWLTMKGSLLRRGKTGTIGLAVTADDRRG"
     MGPVTTEFDR VSSAKYVLLT TFRKDGTPVA TPLWAAADGD RLLMWTVTDS YKVKRIRRNP        60
     EVTVAACDAR GKPKGPEVPA RAVILDAADT DHTRDVIARK YGILGWLTMK GSLLRRGKTG       120
     TIGLAVTADD RRG                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page