(data stored in ACNUC7421 zone)

EMBL: CP000431.PE174

CP000431.PE174       Location/Qualifiers
FT   CDS             232698..234200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00174"
FT                   /product="probable bifunctional protein, CobI-CobJ fusion
FT                   protein: S-adenosyl-L-methionine-precorrin-2 methyl
FT                   transferase + precorrin-3 methylase"
FT                   /EC_number="2.1.1.130"
FT                   /note="GO_function: GO:0030788 - precorrin-2
FT                   C20-methyltransferase activity; GO_process: GO:0009236 -
FT                   cobalamin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00174"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92010"
FT                   /db_xref="GOA:Q0SKC6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC6"
FT                   /protein_id="ABG92010.1"
FT                   /translation="MSSEERVTGKLWGVGIGPGDPELVTVKAARVIAEADVVAFHSARH
FT                   GKSISRAVAAPYLREGQIEEHLVYPVTTETVDHPGGYQGAMDEFYEEASQRLAAHLDAG
FT                   RSVALLAAGDPLFYSSYMHMHKRLVPRFEAEVVPGVTSISAASAALAMPLVEGEEILTV
FT                   LPGTMPPGELTRRLRETDAAAILKLGRTYPAVRQALKDSGRIDETWYVERASTTRQKID
FT                   AADDVSDSDVPYFSIAIVPSPSNARRDDAAPQGELVVVGLGPGDQAWTTPEVQHELSLA
FT                   TDLVGYGPYIDRVPERPGQRRHSSDNRVEAERAAMALDLAKNGSRVAVVSSGDPGVFAM
FT                   AAAVLEVAAEEQWRGVPVRVLPGMTAANAVASRVGAPLGHDYAVLSLSDRLKPWDVVAQ
FT                   RISAVASADMAFAVYNPASKSRTWQVAAMRDLVLEHRSPDTPVIIGRDVAGAQESVRVV
FT                   RLADLDPAEIDMRCLLIVGSSMTTVVENEHGTRVFTPRRYPG"
     MSSEERVTGK LWGVGIGPGD PELVTVKAAR VIAEADVVAF HSARHGKSIS RAVAAPYLRE        60
     GQIEEHLVYP VTTETVDHPG GYQGAMDEFY EEASQRLAAH LDAGRSVALL AAGDPLFYSS       120
     YMHMHKRLVP RFEAEVVPGV TSISAASAAL AMPLVEGEEI LTVLPGTMPP GELTRRLRET       180
     DAAAILKLGR TYPAVRQALK DSGRIDETWY VERASTTRQK IDAADDVSDS DVPYFSIAIV       240
     PSPSNARRDD AAPQGELVVV GLGPGDQAWT TPEVQHELSL ATDLVGYGPY IDRVPERPGQ       300
     RRHSSDNRVE AERAAMALDL AKNGSRVAVV SSGDPGVFAM AAAVLEVAAE EQWRGVPVRV       360
     LPGMTAANAV ASRVGAPLGH DYAVLSLSDR LKPWDVVAQR ISAVASADMA FAVYNPASKS       420
     RTWQVAAMRD LVLEHRSPDT PVIIGRDVAG AQESVRVVRL ADLDPAEIDM RCLLIVGSSM       480
     TTVVENEHGT RVFTPRRYPG                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page