(data stored in ACNUC7421 zone)

EMBL: CP000431.PE176

CP000431.PE176       Location/Qualifiers
FT   CDS             complement(235114..236058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00176"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92012"
FT                   /db_xref="GOA:Q0SKC4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92012.1"
FT                   /translation="MPGKRWRREMGAAGTDSMVAMDLLRHLSFFVAVAEEGHFGNAASR
FT                   LGMTQPPLSQGVRRLEQRLGAELVHRSARGIGLTDAGRQLLPRARLLVADAARFEDEAH
FT                   RIAGGRDAVVRWGVPHSVADGVVVRCVRALRDADETRPTRVVTTTASTTELVDAVRTGS
FT                   LDVAVVEHPALLTGLDSGPVLKLRRWVVVPDDHPAAVAKKAQVRMLRGLALATGPRSDN
FT                   PPAHDLFVDLWRARGLDPDIVVAPGPREIFTHVAAGGHFGVTATAPTVMPGVAWVDLLR
FT                   EDLALRVRIVWRSGTDVAPSAAALDRVLLRAGR"
     MPGKRWRREM GAAGTDSMVA MDLLRHLSFF VAVAEEGHFG NAASRLGMTQ PPLSQGVRRL        60
     EQRLGAELVH RSARGIGLTD AGRQLLPRAR LLVADAARFE DEAHRIAGGR DAVVRWGVPH       120
     SVADGVVVRC VRALRDADET RPTRVVTTTA STTELVDAVR TGSLDVAVVE HPALLTGLDS       180
     GPVLKLRRWV VVPDDHPAAV AKKAQVRMLR GLALATGPRS DNPPAHDLFV DLWRARGLDP       240
     DIVVAPGPRE IFTHVAAGGH FGVTATAPTV MPGVAWVDLL REDLALRVRI VWRSGTDVAP       300
     SAAALDRVLL RAGR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page