(data stored in ACNUC7421 zone)

EMBL: CP000431.PE177

CP000431.PE177       Location/Qualifiers
FT   CDS             236155..237108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00177"
FT                   /product="beta-lactamase, penicillin binding protein"
FT                   /EC_number="3.5.2.6"
FT                   /note="GO_component: GO:0005618 - cell wall; GO_function:
FT                   GO:0008800 - beta-lactamase activity; GO_process:
FT                   GO:0000902 - cellular morphogenesis; GO_process: GO:0009252
FT                   - peptidoglycan biosynthesis; GO_process: GO:0030655 -
FT                   beta-lactam antibiotic catabolism; GO_process: GO:0046677 -
FT                   response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92013"
FT                   /db_xref="GOA:Q0SKC3"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC3"
FT                   /protein_id="ABG92013.1"
FT                   /translation="MSTHRNHPKPRRTGRRGAVALALALPLLLGACTATAEQAQPTTSV
FT                   AAIPDRRSLDATIDALEAQYSTRIGVTAVNPATGEVYSHRGDERFAMCSTFKAYASAAV
FT                   LRKTEDGSTSLDKTVVIEPGDLVENSPVTAAAVGAPMTLGQIAEAALTQSDNTAGNYLL
FT                   REIGGPQAITALARDVGDGGTRLDRWETELNTAFRDDPRDTTTPNGLAQGFRALLLGDA
FT                   LDTASRDQLLEWMRASKTSDKRMRAGLPTGWTAADKTGGGGFGTANDAGVAWSPDGAPL
FT                   VLAILTDSLTNQQDAQGNNQAIADTTAAVIEGLTAP"
     MSTHRNHPKP RRTGRRGAVA LALALPLLLG ACTATAEQAQ PTTSVAAIPD RRSLDATIDA        60
     LEAQYSTRIG VTAVNPATGE VYSHRGDERF AMCSTFKAYA SAAVLRKTED GSTSLDKTVV       120
     IEPGDLVENS PVTAAAVGAP MTLGQIAEAA LTQSDNTAGN YLLREIGGPQ AITALARDVG       180
     DGGTRLDRWE TELNTAFRDD PRDTTTPNGL AQGFRALLLG DALDTASRDQ LLEWMRASKT       240
     SDKRMRAGLP TGWTAADKTG GGGFGTANDA GVAWSPDGAP LVLAILTDSL TNQQDAQGNN       300
     QAIADTTAAV IEGLTAP                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page