(data stored in ACNUC7421 zone)

EMBL: CP000431.PE18

CP000431.PE18        Location/Qualifiers
FT   CDS             27302..27541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91854"
FT                   /db_xref="GOA:Q0SKT2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT2"
FT                   /protein_id="ABG91854.1"
FT                   /translation="MRREALTGLSVGALLGAVMLPVVSLMTGDTMLAFAVAVAVLAASA
FT                   IATVVAMVLHVVAITLQGSRKRRRPSRPARTTPE"
     MRREALTGLS VGALLGAVML PVVSLMTGDT MLAFAVAVAV LAASAIATVV AMVLHVVAIT        60
     LQGSRKRRRP SRPARTTPE                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page