(data stored in ACNUC7421 zone)

EMBL: CP000431.PE180

CP000431.PE180       Location/Qualifiers
FT   CDS             238588..239337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00180"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0016564 - transcriptional repressor
FT                   activity; GO_process: GO:0006808 - regulation of nitrogen
FT                   utilization; GO_process: GO:0009225 - nucleotide-sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92016"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC0"
FT                   /protein_id="ABG92016.1"
FT                   /translation="MKIVIFGTGLIGSQVASKLTETGHDVAALGRGDGIDTTTGKGVAE
FT                   AVEDADVVVDLTNSPSWEDDDVLAFFRESTNHLLAAEEAAGVRHHVVLSIVGADRLPDS
FT                   GYMRAKVAQEDLVKSGPIPYSIVRSTQFFEFIAGIADAGTVGDTVHATPAHLQPIASHD
FT                   VVTRVAEVAVGAPLDGTIEIAGPEPLGIDALVRRLFAATGDQRTVTTDPDTGYFGAKLD
FT                   DAAITPTPGANAWIAPTTLDEWLREHA"
     MKIVIFGTGL IGSQVASKLT ETGHDVAALG RGDGIDTTTG KGVAEAVEDA DVVVDLTNSP        60
     SWEDDDVLAF FRESTNHLLA AEEAAGVRHH VVLSIVGADR LPDSGYMRAK VAQEDLVKSG       120
     PIPYSIVRST QFFEFIAGIA DAGTVGDTVH ATPAHLQPIA SHDVVTRVAE VAVGAPLDGT       180
     IEIAGPEPLG IDALVRRLFA ATGDQRTVTT DPDTGYFGAK LDDAAITPTP GANAWIAPTT       240
     LDEWLREHA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page